PDB entry 2g5d

View 2g5d on RCSB PDB site
Description: Crystal structure of MltA from Neisseria gonorrhoeae Monoclinic form
Class: hydrolase
Keywords: hydrolase, beta barrel
Deposited on 2006-02-22, released 2006-03-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gna33
    Species: Neisseria gonorrhoeae [TaxId:242231]
    Gene: GNA33
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9L6H1 (Start-421)
      • conflict (89)
      • conflict (323)
    Domains in SCOPe 2.08: d2g5da1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2g5dA (A:)
    gsqsrsiqtfpqpdtsvingpdrpagipdpagttvagggavytvvphlsmphwaaqdfak
    slqsfrlgcanlknrqgwqdvcaqafqtpihsfqakrfferyftpwqvagngslagtvtg
    yyepvlkgdgrrterarfpiygipddfisvplpaglrggknlvrirqtgknsgtidnagg
    thtadlsrfpitarttaikgrfegsrflpyhtrnqinggaldgkapilgyaedpvelffm
    hiqgsgrlktpsgkyirigyadknehpyvsigrymadkgylklgqtsmqgikaymrqnpq
    rlaevlgqnpsyiffrelagsggdgpvgalgtplmgeyagaidrhyitlgaplfvatahp
    vtrkalnrlimaqdtgsaikgavrvdyfwgygdeagelagkqkttgyvwqllpngmkpey
    rp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g5dA (A:)
    pdrpagipdpagttvagggavytvvphlsmphwaaqdfakslqsfrlgcanlknrqgwqd
    vcaqafqtpihsfqakrfferyftpwqvagngslagtvtgyyepvlkgdgrrterarfpi
    ygipddfisvplplvrirqtgknsgthtadlsrfpitarttaikgrfegsrflpyhtrnq
    inggaldgkapilgyaedpvelffmhiqgsgrlktpsgkyirigyadknehpyvsigrym
    adkgylklgqtsmqgikaymrqnpqrlaevlgqnpsyiffreldgpvgalgtplmgeyag
    aidrhyitlgaplfvatahpvtrkalnrlimaqdtgsaikgavrvdyfwgygdeagelag
    kqkttgyvwqllpngmkpeyrp