PDB entry 2g5c

View 2g5c on RCSB PDB site
Description: Crystal Structure of Prephenate Dehydrogenase from Aquifex aeolicus
Class: oxidoreductase
Keywords: prephenate dehydrogenase, TyrA, OXIDOREDUCTASE
Deposited on 2006-02-22, released 2006-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.22
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: prephenate dehydrogenase
    Species: Aquifex aeolicus [TaxId:224324]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67636 (1-280)
      • initiating methionine (0)
      • modified residue (11)
      • modified residue (66)
      • modified residue (170)
      • modified residue (200)
      • modified residue (228)
      • modified residue (241)
      • modified residue (278)
    Domains in SCOPe 2.07: d2g5ca1, d2g5ca2
  • Chain 'B':
    Compound: prephenate dehydrogenase
    Species: Aquifex aeolicus [TaxId:224324]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67636 (1-280)
      • modified residue (11)
      • modified residue (66)
      • modified residue (170)
      • modified residue (200)
      • modified residue (228)
      • modified residue (241)
      • modified residue (278)
    Domains in SCOPe 2.07: d2g5cb1, d2g5cb2
  • Chain 'C':
    Compound: prephenate dehydrogenase
    Species: Aquifex aeolicus [TaxId:224324]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67636 (1-End)
      • initiating methionine (0)
      • modified residue (11)
      • modified residue (66)
      • modified residue (170)
      • modified residue (200)
      • modified residue (228)
      • modified residue (241)
    Domains in SCOPe 2.07: d2g5cc1, d2g5cc2
  • Chain 'D':
    Compound: prephenate dehydrogenase
    Species: Aquifex aeolicus [TaxId:224324]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67636 (1-End)
      • initiating methionine (0)
      • modified residue (11)
      • modified residue (66)
      • modified residue (170)
      • modified residue (200)
      • modified residue (228)
      • modified residue (241)
    Domains in SCOPe 2.07: d2g5cd1, d2g5cd2
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2g5cA (A:)
    mqnvlivgvgfmggsfakslrrsgfkgkiygydinpesiskavdlgiidegttsiakved
    fspdfvmlsspvrtfreiakklsyilsedatvtdqgsvkgklvydlenilgkrfvgghpi
    agteksgveysldnlyegkkviltptkktdkkrlklvkrvwedvggvveymspelhdyvf
    gvvshlphavafalvdtlihmstpevdlfkypgggfkdftriaksdpimwrdiflenken
    vmkaiegfekslnhlkelivreaeeelveylkevkikrmei
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g5cA (A:)
    mqnvlivgvgfmggsfakslrrsgfkgkiygydinpesiskavdlgiidegttsiakved
    fspdfvmlsspvrtfreiakklsyilsedatvtdqgsvkgklvydlenilgkrfvgghpi
    agteksgveysldnlyegkkviltptkktdkkrlklvkrvwedvggvveymspelhdyvf
    gvvshlphavafalvdtlihmstpevdlfkypgggfkdfaksdpimwrdiflenkenvmk
    aiegfekslnhlkelivreaeeelveylkevkikrmei
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2g5cB (B:)
    mqnvlivgvgfmggsfakslrrsgfkgkiygydinpesiskavdlgiidegttsiakved
    fspdfvmlsspvrtfreiakklsyilsedatvtdqgsvkgklvydlenilgkrfvgghpi
    agteksgveysldnlyegkkviltptkktdkkrlklvkrvwedvggvveymspelhdyvf
    gvvshlphavafalvdtlihmstpevdlfkypgggfkdftriaksdpimwrdiflenken
    vmkaiegfekslnhlkelivreaeeelveylkevkikrmei
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g5cB (B:)
    qnvlivgvgfmggsfakslrrsgfkgkiygydinpesiskavdlgiidegttsiakvedf
    spdfvmlsspvrtfreiakklsyilsedatvtdqgsvkgklvydlenilgkrfvgghpia
    gteksgveysldnlyegkkviltptkktdkkrlklvkrvwedvggvveymspelhdyvfg
    vvshlphavafalvdtlihmstpevdlfkypgggfkdftriaksdpimwrdiflenkenv
    mkaiegfekslnhlkelivreaeeelveylkevkikrmei
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2g5cC (C:)
    mqnvlivgvgfmggsfakslrrsgfkgkiygydinpesiskavdlgiidegttsiakved
    fspdfvmlsspvrtfreiakklsyilsedatvtdqgsvkgklvydlenilgkrfvgghpi
    agteksgveysldnlyegkkviltptkktdkkrlklvkrvwedvggvveymspelhdyvf
    gvvshlphavafalvdtlihmstpevdlfkypgggfkdftriaksdpimwrdiflenken
    vmkaiegfekslnhlkelivreaeeelveylkevkikrmei
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g5cC (C:)
    mqnvlivgvgfmggsfakslrrsgfkgkiygydinpesiskavdlgiidegttsiakved
    fspdfvmlsspvrtfreiakklsyilsedatvtdqgsvkgklvydlenilgkrfvgghpi
    agteksgveysldnlyegkkviltptkktdkkrlklvkrvwedvggvveymspelhdyvf
    gvvshlphavafalvdtlihmstpevdlfkypgggfkdftriaksdpimwrdiflenken
    vmkaiegfekslnhlkelivreaeeelveylkevkikr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2g5cD (D:)
    mqnvlivgvgfmggsfakslrrsgfkgkiygydinpesiskavdlgiidegttsiakved
    fspdfvmlsspvrtfreiakklsyilsedatvtdqgsvkgklvydlenilgkrfvgghpi
    agteksgveysldnlyegkkviltptkktdkkrlklvkrvwedvggvveymspelhdyvf
    gvvshlphavafalvdtlihmstpevdlfkypgggfkdftriaksdpimwrdiflenken
    vmkaiegfekslnhlkelivreaeeelveylkevkikrmei
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g5cD (D:)
    mqnvlivgvgfmggsfakslrrsgfkgkiygydinpesiskavdlgiidegttsiakved
    fspdfvmlsspvrtfreiakklsyilsedatvtdqgsvkgklvydlenilgkrfvgghpi
    agteksgveysldnlyegkkviltptkktdkkrlklvkrvwedvggvveymspelhdyvf
    gvvshlphavafalvdtlihmstpevdlfkypgggfkdftriaksdpimwrdiflenken
    vmkaiegfekslnhlkelivreaeeelveylkevkikr