PDB entry 2g58

View 2g58 on RCSB PDB site
Description: Crystal structure of a complex of phospholipase A2 with a designed peptide inhibitor Dehydro-Ile-Ala-Arg-Ser at 0.98 A resolution
Class: hydrolase/hydrolase inhibitor
Keywords: Phospholipase A2, dIARS, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2006-02-22, released 2006-03-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 0.98 Å
R-factor: 0.133
AEROSPACI score: 1.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phospholipase A2 VRV-PL-VIIIa
    Species: Daboia russellii pulchella [TaxId:97228]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2g58a_
  • Chain 'B':
    Compound: (phq)iars
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2G58 (0-4)
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2g58A (A:)
    sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
    sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
    c
    

  • Chain 'B':
    No sequence available.