PDB entry 2g52

View 2g52 on RCSB PDB site
Description: Anomalous substructure of trypsin (P21)
Class: hydrolase
Keywords: anomalous substructure of trypsin (p21)
Deposited on 2006-02-22, released 2007-02-20
The last revision prior to the SCOP 1.75 freeze date was dated 2007-03-20, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.157
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trypsin
    Species: Fusarium oxysporum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2g52a1
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2g52A (A:)
ivggtsasagdfpfivsisrnggpwcggsllnantvltaahcvsgyaqsgfqiragslsr
tsggitsslssvrvhpsysgnnndlailklstsipsggnigyarlaasgsdpvagssatv
agwgatseggsstpvnllkvtvpivsratcraqygtsaitnqmfcagvssggkdscqgds
ggpivdssntligavswgngcarpnysgvyasvgalrsfidtya