PDB entry 2g50

View 2g50 on RCSB PDB site
Description: The location of the allosteric amino acid binding site of muscle pyruvate kinase.
Class: transferase
Keywords: allostery, pyruvate kinase, glycolysis, kinase, phosphoryl transfer
Deposited on 2006-02-22, released 2006-05-09
The last revision prior to the SCOP 1.73 freeze date was dated 2006-05-09, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.149
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyruvate kinase isozymes M1/M2
    Species: Oryctolagus cuniculus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11974 (Start-529)
      • see remark 999 (28)
      • see remark 999 (399)
      • see remark 999 (402)
    Domains in SCOP 1.73: d2g50a1, d2g50a2, d2g50a3
  • Chain 'B':
    Compound: Pyruvate kinase isozymes M1/M2
    Species: Oryctolagus cuniculus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11974 (Start-529)
      • see remark 999 (28)
      • see remark 999 (399)
      • see remark 999 (402)
    Domains in SCOP 1.73: d2g50b1, d2g50b2, d2g50b3
  • Chain 'C':
    Compound: Pyruvate kinase isozymes M1/M2
    Species: Oryctolagus cuniculus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11974 (Start-529)
      • see remark 999 (28)
      • see remark 999 (399)
      • see remark 999 (402)
    Domains in SCOP 1.73: d2g50c1, d2g50c2, d2g50c3
  • Chain 'D':
    Compound: Pyruvate kinase isozymes M1/M2
    Species: Oryctolagus cuniculus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11974 (Start-529)
      • see remark 999 (28)
      • see remark 999 (399)
      • see remark 999 (402)
    Domains in SCOP 1.73: d2g50d1, d2g50d2, d2g50d3
  • Chain 'E':
    Compound: Pyruvate kinase isozymes M1/M2
    Species: Oryctolagus cuniculus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11974 (Start-529)
      • see remark 999 (28)
      • see remark 999 (399)
      • see remark 999 (402)
    Domains in SCOP 1.73: d2g50e1, d2g50e2, d2g50e3
  • Chain 'F':
    Compound: Pyruvate kinase isozymes M1/M2
    Species: Oryctolagus cuniculus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11974 (Start-529)
      • see remark 999 (28)
      • see remark 999 (399)
      • see remark 999 (402)
    Domains in SCOP 1.73: d2g50f1, d2g50f2, d2g50f3
  • Chain 'G':
    Compound: Pyruvate kinase isozymes M1/M2
    Species: Oryctolagus cuniculus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11974 (Start-529)
      • see remark 999 (28)
      • see remark 999 (399)
      • see remark 999 (402)
    Domains in SCOP 1.73: d2g50g1, d2g50g2, d2g50g3
  • Chain 'H':
    Compound: Pyruvate kinase isozymes M1/M2
    Species: Oryctolagus cuniculus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11974 (Start-529)
      • see remark 999 (28)
      • see remark 999 (399)
      • see remark 999 (402)
    Domains in SCOP 1.73: d2g50h1, d2g50h2, d2g50h3
  • Heterogens: MN, K, NA, ALA, PYR, EDO, ETE, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2g50A (A:)
    skshseagsafiqtqqlhaamadtflehkcrldidsapitarntgiictigpasrsvetl
    kemiksgmnvarmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirt
    glikgsgtaevelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddgli
    slqvkqkgpdflvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvf
    asfirkaadvhevrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgiei
    paekvflaqkmiigrcnragkpvicatqmlesmikkprptraegsdvanavldgadciml
    sgetakgdypleavrmqhliareaeaamfhrklfeelarassqstdlmeamamgsveasy
    kclaaalivltesgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqea
    waedvdlrvnlamnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g50A (A:)
    iqtqqlhaamadtflehkcrldidsapitarntgiictigpasrsvetlkemiksgmnva
    rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglikgsgtaev
    elkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkgpdf
    lvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaadvh
    evrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkm
    iigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypl
    eavrmqhliareaeaamfhrklfeelarassqstdlmeamamgsveasykclaaalivlt
    esgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnl
    amnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2g50B (B:)
    skshseagsafiqtqqlhaamadtflehkcrldidsapitarntgiictigpasrsvetl
    kemiksgmnvarmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirt
    glikgsgtaevelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddgli
    slqvkqkgpdflvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvf
    asfirkaadvhevrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgiei
    paekvflaqkmiigrcnragkpvicatqmlesmikkprptraegsdvanavldgadciml
    sgetakgdypleavrmqhliareaeaamfhrklfeelarassqstdlmeamamgsveasy
    kclaaalivltesgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqea
    waedvdlrvnlamnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g50B (B:)
    fiqtqqlhaamadtflehkcrldidsapitarntgiictigpasrsvetlkemiksgmnv
    armnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglaevelkkg
    atlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkflvteveng
    gflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaadvhevrkilge
    kgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkmiigrcnra
    gkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypleavrmqhl
    iareaeaamfhrklfeelarassqstdlmeamamgsveasykclaaalivltesgrsahq
    varyrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnlamnvgkar
    gffkkgdvvivltgwrpgsgftntmrvvpvp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2g50C (C:)
    skshseagsafiqtqqlhaamadtflehkcrldidsapitarntgiictigpasrsvetl
    kemiksgmnvarmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirt
    glikgsgtaevelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddgli
    slqvkqkgpdflvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvf
    asfirkaadvhevrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgiei
    paekvflaqkmiigrcnragkpvicatqmlesmikkprptraegsdvanavldgadciml
    sgetakgdypleavrmqhliareaeaamfhrklfeelarassqstdlmeamamgsveasy
    kclaaalivltesgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqea
    waedvdlrvnlamnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g50C (C:)
    iqtqqlhaamadtflehkcrldidsapitarntgiictigpasrsvetlkemiksgmnva
    rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtgliaevelkkg
    atlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkdflvteven
    ggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaadvhevrkilg
    ekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkmiigrcnr
    agkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypleavrmqh
    liareaeaamfhrklfeelarassqstdlmeamamgsveasykclaaalivltesgrsah
    qvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnlamnvgka
    rgffkkgdvvivltgwrpgsgftntmrvvpvp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2g50D (D:)
    skshseagsafiqtqqlhaamadtflehkcrldidsapitarntgiictigpasrsvetl
    kemiksgmnvarmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirt
    glikgsgtaevelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddgli
    slqvkqkgpdflvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvf
    asfirkaadvhevrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgiei
    paekvflaqkmiigrcnragkpvicatqmlesmikkprptraegsdvanavldgadciml
    sgetakgdypleavrmqhliareaeaamfhrklfeelarassqstdlmeamamgsveasy
    kclaaalivltesgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqea
    waedvdlrvnlamnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g50D (D:)
    afiqtqqlhaamadtflehkcrldidsapitarntgiictigpasrsvetlkemiksgmn
    varmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglikgsgta
    evelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkgp
    dflvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaad
    vhevrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaq
    kmiigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdy
    pleavrmqhliareaeaamfhrklfeelarassqstdlmeamamgsveasykclaaaliv
    ltesgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrv
    nlamnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2g50E (E:)
    skshseagsafiqtqqlhaamadtflehkcrldidsapitarntgiictigpasrsvetl
    kemiksgmnvarmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirt
    glikgsgtaevelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddgli
    slqvkqkgpdflvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvf
    asfirkaadvhevrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgiei
    paekvflaqkmiigrcnragkpvicatqmlesmikkprptraegsdvanavldgadciml
    sgetakgdypleavrmqhliareaeaamfhrklfeelarassqstdlmeamamgsveasy
    kclaaalivltesgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqea
    waedvdlrvnlamnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g50E (E:)
    afiqtqqlhaamadtflehkcrldidsapitarntgiictigpasrsvetlkemiksgmn
    varmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglikgsgta
    evelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkgp
    dflvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaad
    vhevrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaq
    kmiigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdy
    pleavrmqhliareaeaamfhrklfeelarassqstdlmeamamgsveasykclaaaliv
    ltesgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrv
    nlamnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2g50F (F:)
    skshseagsafiqtqqlhaamadtflehkcrldidsapitarntgiictigpasrsvetl
    kemiksgmnvarmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirt
    glikgsgtaevelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddgli
    slqvkqkgpdflvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvf
    asfirkaadvhevrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgiei
    paekvflaqkmiigrcnragkpvicatqmlesmikkprptraegsdvanavldgadciml
    sgetakgdypleavrmqhliareaeaamfhrklfeelarassqstdlmeamamgsveasy
    kclaaalivltesgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqea
    waedvdlrvnlamnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g50F (F:)
    fiqtqqlhaamadtflehkcrldidsapitarntgiictigpasrsvetlkemiksgmnv
    armnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtgliktaevel
    kkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkdflvte
    venggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaadvhevrk
    ilgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkmiigr
    cnragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypleavr
    mqhliareaeaamfhrklfeelarassqstdlmeamamgsveasykclaaalivltesgr
    sahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnlamnv
    gkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2g50G (G:)
    skshseagsafiqtqqlhaamadtflehkcrldidsapitarntgiictigpasrsvetl
    kemiksgmnvarmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirt
    glikgsgtaevelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddgli
    slqvkqkgpdflvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvf
    asfirkaadvhevrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgiei
    paekvflaqkmiigrcnragkpvicatqmlesmikkprptraegsdvanavldgadciml
    sgetakgdypleavrmqhliareaeaamfhrklfeelarassqstdlmeamamgsveasy
    kclaaalivltesgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqea
    waedvdlrvnlamnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g50G (G:)
    fiqtqqlhaamadtflehkcrldidsapitarntgiictigpasrsvetlkemiksgmnv
    armnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglevelkkga
    tlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkflvtevengg
    flgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaadvhevrkilgek
    gknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkmiigrcnrag
    kpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypleavrmqhli
    areaeaamfhrklfeelarassqstdlmeamamgsveasykclaaalivltesgrsahqv
    aryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnlamnvgkarg
    ffkkgdvvivltgwrpgsgftntmrvvpvp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2g50H (H:)
    skshseagsafiqtqqlhaamadtflehkcrldidsapitarntgiictigpasrsvetl
    kemiksgmnvarmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirt
    glikgsgtaevelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddgli
    slqvkqkgpdflvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvf
    asfirkaadvhevrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgiei
    paekvflaqkmiigrcnragkpvicatqmlesmikkprptraegsdvanavldgadciml
    sgetakgdypleavrmqhliareaeaamfhrklfeelarassqstdlmeamamgsveasy
    kclaaalivltesgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqea
    waedvdlrvnlamnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g50H (H:)
    fiqtqqlhaamadtflehkcrldidsapitarntgiictigpasrsvetlkemiksgmnv
    armnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglikgsgtae
    velkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkgdf
    lvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaadvh
    evrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkm
    iigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypl
    eavrmqhliareaeaamfhrklfeelarassqstdlmeamamgsveasykclaaalivlt
    esgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnl
    amnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp