PDB entry 2g4i

View 2g4i on RCSB PDB site
Description: Anomalous substructure of Concanavalin A
Class: metal binding protein
Keywords: anomalous substructure of concanavalin A, METAL BINDING PROTEIN
Deposited on 2006-02-22, released 2007-02-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.193
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: concanavalin a
    Species: Canavalia virosa [TaxId:28958]
    Database cross-references and differences (RAF-indexed):
    • GB 1102245A (0-236)
      • see remark 999 (150)
      • see remark 999 (154)
    Domains in SCOPe 2.08: d2g4ia_
  • Heterogens: MN, CA, NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2g4iA (A:)
    adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
    lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
    hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
    iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan