PDB entry 2g4d

View 2g4d on RCSB PDB site
Description: Crystal structure of human SENP1 mutant (C603S) in complex with SUMO-1
Class: Hydrolase/PROTEIN BINDING
Keywords: protease, ubiquitin-like protein, SUMO maturation, SUMO deconjugation
Deposited on 2006-02-22, released 2006-10-17
The last revision prior to the SCOP 1.73 freeze date was dated 2006-10-17, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.248
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SENP1 protein
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9P0U3 (0-204)
      • engineered (163)
  • Chain 'B':
    Compound: Small ubiquitin-related modifier 1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2g4db1
  • Chain 'C':
    Compound: SENP1 protein
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9P0U3 (0-204)
      • engineered (163)
  • Chain 'D':
    Compound: Small ubiquitin-related modifier 1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2g4dd1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2g4dB (B:)
eyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpke
lgmeeedvievyqeqtgg

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2g4dD (D:)
eyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpke
lgmeeedvievyqeqtgg