PDB entry 2g46

View 2g46 on RCSB PDB site
Description: structure of vSET in complex with meK27 H3 Pept. and cofactor product SAH
Class: transferase
Keywords: vSET structure, hsitone methyltransferase, NMR
Deposited on 2006-02-21, released 2006-12-05
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: PBCV-1 histone H3-Lys 27 methyltransferase
  Species: Paramecium bursaria Chlorella virus 1 [TaxId:10506]
  Gene: A612L
  Database cross-references and differences (RAF-indexed):
  • GB NP_048968 (0-118)
  Domains in SCOPe 2.04: d2g46a_
• Chain 'B':
  Compound: PBCV-1 histone H3-Lys 27 methyltransferase
  Species: Paramecium bursaria Chlorella virus 1 [TaxId:10506]
  Gene: A612L
  Database cross-references and differences (RAF-indexed):
  • GB NP_048968 (0-118)
  Domains in SCOPe 2.04: d2g46b_
• Chain 'C':
  Compound: meK27 H3 Peptide
  Database cross-references and differences (RAF-indexed):
  • PDB 2G46 (0-20)
• Chain 'D':
  Compound: meK27 H3 Peptide
  Database cross-references and differences (RAF-indexed):
  • PDB 2G46 (0-20)
• Heterogens: SAH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2g46A (A:)
  mfndrvivkksplggygvfarksfekgelveeclcivrhnddwgtaledylfsrknmsam
  algfgaifnhskdpnarheltaglkrmriftikpiaigeeitisygddywlsrprltqn
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2g46B (B:)
  mfndrvivkksplggygvfarksfekgelveeclcivrhnddwgtaledylfsrknmsam
  algfgaifnhskdpnarheltaglkrmriftikpiaigeeitisygddywlsrprltqn
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.