PDB entry 2g46
View 2g46 on RCSB PDB site
Description: structure of vSET in complex with meK27 H3 Pept. and cofactor product SAH
Class: transferase
Keywords: vSET structure, hsitone methyltransferase, NMR
Deposited on
2006-02-21, released
2006-12-05
The last revision prior to the SCOPe 2.01 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: PBCV-1 histone H3-Lys 27 methyltransferase
Species: Paramecium bursaria Chlorella virus 1 [TaxId:10506]
Gene: A612L
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.01: d2g46a1 - Chain 'B':
Compound: PBCV-1 histone H3-Lys 27 methyltransferase
Species: Paramecium bursaria Chlorella virus 1 [TaxId:10506]
Gene: A612L
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.01: d2g46b1 - Chain 'C':
Compound: meK27 H3 Peptide
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: meK27 H3 Peptide
Database cross-references and differences (RAF-indexed):
- Heterogens: SAH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2g46A (A:)
mfndrvivkksplggygvfarksfekgelveeclcivrhnddwgtaledylfsrknmsam
algfgaifnhskdpnarheltaglkrmriftikpiaigeeitisygddywlsrprltqn
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2g46B (B:)
mfndrvivkksplggygvfarksfekgelveeclcivrhnddwgtaledylfsrknmsam
algfgaifnhskdpnarheltaglkrmriftikpiaigeeitisygddywlsrprltqn
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.