PDB entry 2g46

View 2g46 on RCSB PDB site
Description: structure of vSET in complex with meK27 H3 Pept. and cofactor product SAH
Class: transferase
Keywords: vSET structure, hsitone methyltransferase, NMR
Deposited on 2006-02-21, released 2006-12-05
The last revision prior to the SCOP 1.73 freeze date was dated 2006-12-05, with a file datestamp of 2007-06-28.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PBCV-1 histone H3-Lys 27 methyltransferase
    Species: Paramecium bursaria Chlorella virus 1
    Gene: A612L
    Database cross-references and differences (RAF-indexed):
    • GB NP_048968 (0-118)
    Domains in SCOP 1.73: d2g46a1
  • Chain 'B':
    Compound: PBCV-1 histone H3-Lys 27 methyltransferase
    Species: Paramecium bursaria Chlorella virus 1
    Gene: A612L
    Database cross-references and differences (RAF-indexed):
    • GB NP_048968 (0-118)
    Domains in SCOP 1.73: d2g46b1
  • Chain 'C':
    Compound: meK27 H3 Peptide
  • Chain 'D':
    Compound: meK27 H3 Peptide
  • Heterogens: SAH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2g46A (A:)
    mfndrvivkksplggygvfarksfekgelveeclcivrhnddwgtaledylfsrknmsam
    algfgaifnhskdpnarheltaglkrmriftikpiaigeeitisygddywlsrprltqn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2g46B (B:)
    mfndrvivkksplggygvfarksfekgelveeclcivrhnddwgtaledylfsrknmsam
    algfgaifnhskdpnarheltaglkrmriftikpiaigeeitisygddywlsrprltqn
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.