PDB entry 2g3y

View 2g3y on RCSB PDB site
Description: Crystal structure of the human small GTPase GEM
Class: signaling protein
Keywords: GEM, small GTPase, GDP, inactive state, RGK family, Structural Genomics, Structural Genomics Consortium, SGC, SIGNALING PROTEIN
Deposited on 2006-02-21, released 2006-04-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.22
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP-binding protein gem
    Species: Homo sapiens [TaxId:9606]
    Gene: GEM, KIR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2g3ya1
  • Heterogens: GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2g3yA (A:)
    mhhhhhhssgvdlgtenlyfqsmstdsvissesgntyyrvvligeqgvgkstlanifagv
    hdsmdsdcevlgedtyertlmvdgesatiilldmwenkgenewlhdhcmqvgdaylivys
    itdrasfekaselriqlrrarqtedipiilvgnksdlvrcrevsvsegracavvfdckfi
    etsaavqhnvkelfegivrqvrlrrdskekn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g3yA (A:)
    ntyyrvvligeqgvgkstlanifagvhdsmdsdlgedtyertlmvdgesatiilldmwen
    kgenewlhdhcmqvgdaylivysitdrasfekaselriqlrrarqtedipiilvgnksdl
    vrcrevsvsegracavvfdckfietsaavqhnvkelfegivrqvrlrrd