PDB entry 2g3r

View 2g3r on RCSB PDB site
Description: Crystal Structure of 53BP1 tandem tudor domains at 1.2 A resolution
Class: cell cycle/transcription
Keywords: tandem tudor domains
Deposited on 2006-02-20, released 2007-01-02
The last revision prior to the SCOP 1.73 freeze date was dated 2007-01-09, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.196
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tumor suppressor p53-binding protein 1
    Species: HOMO SAPIENS
    Gene: TP53BP1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2g3ra1, d2g3ra2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2g3rA (A:)
    ghmnsfvglrvvakwssngyfysgkitrdvgagkykllfddgyecdvlgkdillcdpipl
    dtevtalsedeyfsagvvkghrkesgelyysiekegqrkwykrmavilsleqgnrlreqy
    glg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g3rA (A:)
    sfvglrvvakwssngyfysgkitrdvgagkykllfddgyecdvlgkdillcdpipldtev
    talsedeyfsagvvkghrkesgelyysiekegqrkwykrmavilsleqgnrlreqyglg