PDB entry 2g3q

View 2g3q on RCSB PDB site
Description: Solution Structure of Ede1 UBA-ubiquitin complex
Class: endocytosis/signaling protein
Keywords: endocytosis, monoubiquitin signaling, solution structure, UBA domain, ubiquitin-binding motif, ENDOCYTOSIS/SIGNALING PROTEIN COMPLEX
Deposited on 2006-02-20, released 2006-05-09
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein YBL047C
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: Ede1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2g3qa1
  • Chain 'B':
    Compound: Ubiquitin
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2g3qb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2g3qA (A:)
    ttpkslaveelsgmgfteeeahnalekcnwdleaatnflldsa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2g3qB (B:)
    mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrgg