PDB entry 2g3q

View 2g3q on RCSB PDB site
Description: Solution Structure of Ede1 UBA-ubiquitin complex
Class: endocytosis/signaling protein
Keywords: endocytosis, monoubiquitin signaling, solution structure, UBA domain, ubiquitin-binding motif, ENDOCYTOSIS/SIGNALING PROTEIN COMPLEX
Deposited on 2006-02-20, released 2006-05-09
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protein YBL047C
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Gene: Ede1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P34216 (0-42)
  Domains in SCOPe 2.01: d2g3qa1
• Chain 'B':
  Compound: Ubiquitin
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61864 (0-75)
  Domains in SCOPe 2.01: d2g3qb1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2g3qA (A:)
  ttpkslaveelsgmgfteeeahnalekcnwdleaatnflldsa
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2g3qB (B:)
  mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
  iqkestlhlvlrlrgg