PDB entry 2g3o

View 2g3o on RCSB PDB site
Description: The 2.1A crystal structure of copGFP
Class: luminescent protein
Keywords: beta-barrel, chromophore, GFP, LUMINESCENT PROTEIN
Deposited on 2006-02-20, released 2006-08-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.233
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: green fluorescent protein 2
    Species: Pontellina plumata [TaxId:239963]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6WV12
      • chromophore (56)
    Domains in SCOPe 2.06: d2g3oa_
  • Chain 'B':
    Compound: green fluorescent protein 2
    Species: Pontellina plumata [TaxId:239963]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6WV12
      • chromophore (56)
    Domains in SCOPe 2.06: d2g3ob_
  • Chain 'C':
    Compound: green fluorescent protein 2
    Species: Pontellina plumata [TaxId:239963]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6WV12
      • chromophore (56)
    Domains in SCOPe 2.06: d2g3oc_
  • Chain 'D':
    Compound: green fluorescent protein 2
    Species: Pontellina plumata [TaxId:239963]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6WV12
      • chromophore (56)
    Domains in SCOPe 2.06: d2g3od_
  • Chain 'E':
    Compound: green fluorescent protein 2
    Species: Pontellina plumata [TaxId:239963]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6WV12
      • chromophore (56)
    Domains in SCOPe 2.06: d2g3oe_
  • Chain 'F':
    Compound: green fluorescent protein 2
    Species: Pontellina plumata [TaxId:239963]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6WV12
      • chromophore (56)
    Domains in SCOPe 2.06: d2g3of_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2g3oA (A:)
    mpamkiecritgtlngvefelvgggegtpeqgrmtnkmkstkgaltfspyllshvmgygf
    yhfgtypsgyenpflhainnggytntriekyedggvlhvsfsyryeagrvigdfkvvgtg
    fpedsviftdkiirsnatvehlhpmgdnvlvgsfartfslrdggyysfvvdshmhfksai
    hpsilqnggpmfafrrveelhsntelgiveyqhafktpiafa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g3oA (A:)
    amkiecritgtlngvefelvgggegtpeqgrmtnkmkstkgaltfspyllshvmgygfyh
    fgtypsgyenpflhainnggytntriekyedggvlhvsfsyryeagrvigdfkvvgtgfp
    edsviftdkiirsnatvehlhpmgdnvlvgsfartfslrdggyysfvvdshmhfksaihp
    silggpmfafrrveelhsntelgiveyqhafktp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2g3oB (B:)
    mpamkiecritgtlngvefelvgggegtpeqgrmtnkmkstkgaltfspyllshvmgygf
    yhfgtypsgyenpflhainnggytntriekyedggvlhvsfsyryeagrvigdfkvvgtg
    fpedsviftdkiirsnatvehlhpmgdnvlvgsfartfslrdggyysfvvdshmhfksai
    hpsilqnggpmfafrrveelhsntelgiveyqhafktpiafa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g3oB (B:)
    amkiecritgtlngvefelvgggegtpeqgrmtnkmkstkgaltfspyllshvmgygfyh
    fgtypsgyenpflhaingytntriekyedggvlhvsfsyryeagrvigdfkvvgtgfped
    sviftdkiirsnatvehlhpmgdnvlvgsfartfslrdggyysfvvdshmhfksaihpsi
    lqnggpmfafrrveelhsntelgiveyqhafktpi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2g3oC (C:)
    mpamkiecritgtlngvefelvgggegtpeqgrmtnkmkstkgaltfspyllshvmgygf
    yhfgtypsgyenpflhainnggytntriekyedggvlhvsfsyryeagrvigdfkvvgtg
    fpedsviftdkiirsnatvehlhpmgdnvlvgsfartfslrdggyysfvvdshmhfksai
    hpsilqnggpmfafrrveelhsntelgiveyqhafktpiafa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g3oC (C:)
    pamkiecritgtlngvefelvgggegtpeqgrmtnkmkstkgaltfspyllshvmgygfy
    hfgtypsgyenpflhainnggytntriekyedggvlhvsfsyryeagrvigdfkvvgtgf
    pedsviftdkiirsnatvehlhpmgdnvlvgsfartfslrdggyysfvvdshmhfksaih
    psilqnggpmfafrrveelhsntelgiveyqhafktpi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2g3oD (D:)
    mpamkiecritgtlngvefelvgggegtpeqgrmtnkmkstkgaltfspyllshvmgygf
    yhfgtypsgyenpflhainnggytntriekyedggvlhvsfsyryeagrvigdfkvvgtg
    fpedsviftdkiirsnatvehlhpmgdnvlvgsfartfslrdggyysfvvdshmhfksai
    hpsilqnggpmfafrrveelhsntelgiveyqhafktpiafa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g3oD (D:)
    pamkiecritgtlngvefelvgggegtpeqgrmtnkmkstkgaltfspyllshvmgygfy
    hfgtypsgyenpflhainnggytntriekyedggvlhvsfsyryeagrvigdfkvvgtgf
    pedsviftdkiirsnatvehlhpmgdnvlvgsfartfslrdggyysfvvdshmhfksaih
    psilqnggpmfafrrveelhsntelgiveyqhafktpi
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2g3oE (E:)
    mpamkiecritgtlngvefelvgggegtpeqgrmtnkmkstkgaltfspyllshvmgygf
    yhfgtypsgyenpflhainnggytntriekyedggvlhvsfsyryeagrvigdfkvvgtg
    fpedsviftdkiirsnatvehlhpmgdnvlvgsfartfslrdggyysfvvdshmhfksai
    hpsilqnggpmfafrrveelhsntelgiveyqhafktpiafa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g3oE (E:)
    pamkiecritgtlngvefelvgggegtpeqgrmtnkmkstkgaltfspyllshvmgygfy
    hfgtypsgyenpflhainnggytntriekyedggvlhvsfsyryeagrvigdfkvvgtgf
    pedsviftdkiirsnatvehlhpmgdnvlvgsfartfslrdggyysfvvdshmhfksaih
    psilqnggpmfafrrveelhsntelgiveyqhafktpi
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2g3oF (F:)
    mpamkiecritgtlngvefelvgggegtpeqgrmtnkmkstkgaltfspyllshvmgygf
    yhfgtypsgyenpflhainnggytntriekyedggvlhvsfsyryeagrvigdfkvvgtg
    fpedsviftdkiirsnatvehlhpmgdnvlvgsfartfslrdggyysfvvdshmhfksai
    hpsilqnggpmfafrrveelhsntelgiveyqhafktpiafa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g3oF (F:)
    pamkiecritgtlngvefelvgggegtpeqgrmtnkmkstkgaltfspyllshvmgygfy
    hfgtypsgyenpflhainnggytntriekyedggvlhvsfsyryeagrvigdfkvvgtgf
    pedsviftdkiirsnatvehlhpmgdnvlvgsfartfslrdggyysfvvdshmhfksaih
    psilqnggpmfafrrveelhsntelgiveyqhafktpi