PDB entry 2g3k

View 2g3k on RCSB PDB site
Description: Crystal structure of the C-terminal domain of Vps28
Class: transport protein
Keywords: 4 helix bundle, TRANSPORT PROTEIN
Deposited on 2006-02-20, released 2006-06-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.05 Å
R-factor: 0.216
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vacuolar protein sorting-associated protein vps28
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: VPS28
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02767 (0-93)
      • modified residue (16)
    Domains in SCOPe 2.08: d2g3ka1
  • Chain 'B':
    Compound: vacuolar protein sorting-associated protein vps28
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: VPS28
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02767 (0-93)
      • modified residue (16)
    Domains in SCOPe 2.08: d2g3kb_
  • Chain 'C':
    Compound: vacuolar protein sorting-associated protein vps28
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: VPS28
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02767 (0-93)
      • modified residue (16)
    Domains in SCOPe 2.08: d2g3kc_
  • Chain 'D':
    Compound: vacuolar protein sorting-associated protein vps28
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: VPS28
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02767 (0-93)
      • modified residue (16)
    Domains in SCOPe 2.08: d2g3kd_
  • Chain 'E':
    Compound: vacuolar protein sorting-associated protein vps28
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: VPS28
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02767 (0-93)
      • modified residue (16)
    Domains in SCOPe 2.08: d2g3ke_
  • Chain 'F':
    Compound: vacuolar protein sorting-associated protein vps28
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: VPS28
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02767 (0-93)
      • modified residue (16)
    Domains in SCOPe 2.08: d2g3kf_
  • Chain 'G':
    Compound: vacuolar protein sorting-associated protein vps28
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: VPS28
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02767 (0-93)
      • modified residue (16)
    Domains in SCOPe 2.08: d2g3kg_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2g3kA (A:)
    fnakyvaeatgnfitvmdalklnynakdqlhpllaellisinrvtrddfenrsklidwiv
    rinklsigdtltetqirellfdlelayksfyall
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2g3kB (B:)
    fnakyvaeatgnfitvmdalklnynakdqlhpllaellisinrvtrddfenrsklidwiv
    rinklsigdtltetqirellfdlelayksfyall
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2g3kC (C:)
    fnakyvaeatgnfitvmdalklnynakdqlhpllaellisinrvtrddfenrsklidwiv
    rinklsigdtltetqirellfdlelayksfyall
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2g3kD (D:)
    fnakyvaeatgnfitvmdalklnynakdqlhpllaellisinrvtrddfenrsklidwiv
    rinklsigdtltetqirellfdlelayksfyall
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2g3kE (E:)
    fnakyvaeatgnfitvmdalklnynakdqlhpllaellisinrvtrddfenrsklidwiv
    rinklsigdtltetqirellfdlelayksfyall
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2g3kF (F:)
    fnakyvaeatgnfitvmdalklnynakdqlhpllaellisinrvtrddfenrsklidwiv
    rinklsigdtltetqirellfdlelayksfyall
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2g3kG (G:)
    fnakyvaeatgnfitvmdalklnynakdqlhpllaellisinrvtrddfenrsklidwiv
    rinklsigdtltetqirellfdlelayksfyall