PDB entry 2g3h

View 2g3h on RCSB PDB site
Description: Cyanide Binding and Heme Cavity Conformational Transitions in Drosophila melanogaster Hexa-coordinate Hemoglobin
Class: transport protein
Keywords: Drosophila melanogaster hemoglobin structure; hexa-coordinate hemoglobin; cyanide binding to hemoglobin; heme distal site structure; fruit fly hemoglobin, TRANSPORT PROTEIN
Deposited on 2006-02-20, released 2006-10-03
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.156
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: globin
  Species: Drosophila melanogaster [TaxId:7227]
  Gene: glob1
  Database cross-references and differences (RAF-indexed):
  • GB NP_732081 (0-152)
    • engineered (120)
  Domains in SCOPe 2.02: d2g3ha_
• Heterogens: CL, MG, CYN, HEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2g3hA (A:)
  mnsdevqlikktweipvatptdsgaailtqffnrfpsnlekfpfrdvpleelsgnarfra
  hagriirvfdesiqvlgqdgdlekldeiwtkiavshiprtvskesynqlkgvildvltaa
  ssldesqaatwaklvdhvygiifkaidddgnak