PDB entry 2g3b

View 2g3b on RCSB PDB site
Description: Crystal structure of putative TetR-family transcriptional regulator from Rhodococcus sp.
Class: transcription
Keywords: transcription regulator, TetR-family, structural genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, TRANSCRIPTION
Deposited on 2006-02-17, released 2006-03-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.188
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative tetR-family transcriptional regulator
    Species: Rhodococcus sp. [TaxId:101510]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2g3ba1, d2g3ba2
  • Chain 'B':
    Compound: Putative tetR-family transcriptional regulator
    Species: Rhodococcus sp. [TaxId:101510]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2g3bb1, d2g3bb2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2g3bA (A:)
    mserrdailkasataiaqrgirglrvndvaevagvspgllyyhfkdriglleaalnyind
    rarayrsegegsgdsardrltrsllgeiqdrpevvenslawnelrasavyeealrdplar
    ttaawvseiadaivqaqatgeisrsldpqptavtmtalveglsgrwlckeistedarshl
    lgaidvvmsepthhtadtpvtptpkeyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g3bA (A:)
    mserrdailkasataiaqrgirglrvndvaevagvspgllyyhfkdriglleaalnyind
    rarayrsegeggdsardrltrsllgeiqdrpevvenslawnelrasavyeealrdplart
    taawvseiadaivqaqatgeisrsldpqptavtmtalveglsgrwlckeistedarshll
    gaidvvms
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2g3bB (B:)
    mserrdailkasataiaqrgirglrvndvaevagvspgllyyhfkdriglleaalnyind
    rarayrsegegsgdsardrltrsllgeiqdrpevvenslawnelrasavyeealrdplar
    ttaawvseiadaivqaqatgeisrsldpqptavtmtalveglsgrwlckeistedarshl
    lgaidvvmsepthhtadtpvtptpkeyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g3bB (B:)
    serrdailkasataiaqrgirglrvndvaevagvspgllyyhfkdriglleaalnyindr
    arayrsegegsgdsardrltrsllgeiqdrpevvenslawnelrasavyeealrdplart
    taawvseiadaivqaqatgeisrsldpqptavtmtalveglsgrwlckeistedarshll
    gaidvvms