PDB entry 2g35

View 2g35 on RCSB PDB site
Description: NMR structure of talin-PTB in complex with PIPKI
Class: structural protein
Keywords: talin, ptb domain, pipki
Deposited on 2006-02-17, released 2006-05-02
The last revision prior to the SCOP 1.75 freeze date was dated 2006-05-23, with a file datestamp of 2007-07-20.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Talin-1
    Species: MUS MUSCULUS
    Gene: Tln1, Tln
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2g35a1
  • Chain 'B':
    Compound: peptide

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2g35A (A:)
lktygvsfflvkekmkgknklvprllgitkecvmrvdektkeviqewsltnikrwaaspk
sftldfgdyqdgyysvqttegeqiaqliagyidiilkkkk

  • Chain 'B':
    No sequence available.