PDB entry 2g35

View 2g35 on RCSB PDB site
Description: NMR structure of talin-PTB in complex with PIPKI
Class: structural protein
Keywords: talin, ptb domain, pipki, structural protein
Deposited on 2006-02-17, released 2006-05-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Talin-1
    Species: Mus musculus [TaxId:10090]
    Gene: Tln1, Tln
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2g35a1
  • Chain 'B':
    Compound: peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 2G35 (0-7)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2g35A (A:)
lktygvsfflvkekmkgknklvprllgitkecvmrvdektkeviqewsltnikrwaaspk
sftldfgdyqdgyysvqttegeqiaqliagyidiilkkkk

  • Chain 'B':
    No sequence available.