PDB entry 2g30

View 2g30 on RCSB PDB site
Description: beta appendage of AP2 complexed with ARH peptide
Class: endocytosis/exocytosis
Keywords: alpha-helical ARH peptide, platform domain, sandwich domain, endocytosis, adaptor
Deposited on 2006-02-17, released 2006-03-14
The last revision prior to the SCOP 1.73 freeze date was dated 2006-03-14, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.216
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: AP-2 complex subunit beta-1
    Species: HOMO SAPIENS
    Gene: AP2B1, CLAPB1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2g30a1, d2g30a2
  • Chain 'P':
    Compound: 16-mer peptide from Low density lipoprotein receptor adapter protein 1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: peptide sequence AAF
    Species: synthetic, synthetic
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2g30A (A:)
    mgsshhhhhhssglvprgshmgmapggyvapkavwlpavkakgleisgtfthrqghiyme
    mnftnkalqhmtdfaiqfnknsfgvipstplaihtplmpnqsidvslplntlgpvmkmep
    lnnlqvavknnidvfyfscliplnvlfvedgkmerqvflatwkdipnenelqfqikechl
    nadtvssklqnnnvytiakrnvegqdmlyqslkltngiwilaelriqpgnpnytlslkcr
    apevsqyiyqvydsilkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g30A (A:)
    ggyvapkavwlpavkakgleisgtfthrqghiymemnftnkalqhmtdfaiqfnknsfgv
    ipstplaihtplmpnqsidvslplntlgpvmkmeplnnlqvavknnidvfyfscliplnv
    lfvedgkmerqvflatwkdipnenelqfqikechlnadtvssklqnnnvytiakrnvegq
    dmlyqslkltngiwilaelriqpgnpnytlslkcrapevsqyiyqvydsilkn
    

  • Chain 'P':
    No sequence available.

  • Chain 'S':
    No sequence available.