PDB entry 2g2r

View 2g2r on RCSB PDB site
Description: Green-fluorescent antibody 11G10 in complex with its hapten (nitro-stilbene derivative)
Class: immune system
Keywords: immunoglobulin,green-fluorescent antibody, stilbene-complex, IMMUNE SYSTEM
Deposited on 2006-02-16, released 2006-12-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.205
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Green-fluorescent antibody (11G10)-light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2G2R (0-218)
    Domains in SCOPe 2.07: d2g2ra1, d2g2ra2
  • Chain 'B':
    Compound: Green-fluorescent antibody (11G10)-heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Green-fluorescent antibody (11G10)-heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Green-fluorescent antibody (11G10)-light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2G2R (0-218)
    Domains in SCOPe 2.07: d2g2rl1, d2g2rl2
  • Heterogens: SO4, TNS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2g2rA (A:)
    dvvmtqtpltlsvtigqpasiscrssqsllyingkthlnwllqrpgqspkrliylvskld
    sgvpdrfsgsgsgtdftlkisrveaedlgiyfclqsthfpltfgagtklelkradaaptv
    sifppsseqltsggasvvcflnnfyprdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2g2rL (L:)
    dvvmtqtpltlsvtigqpasiscrssqsllyingkthlnwllqrpgqspkrliylvskld
    sgvpdrfsgsgsgtdftlkisrveaedlgiyfclqsthfpltfgagtklelkradaaptv
    sifppsseqltsggasvvcflnnfyprdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec