PDB entry 2g2l

View 2g2l on RCSB PDB site
Description: Crystal Structure of the Second PDZ Domain of SAP97 in Complex with a GluR-A C-terminal Peptide
Class: membrane protein
Keywords: membrane protein, synaptic signaling, trafficking protein
Deposited on 2006-02-16, released 2006-08-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Synapse-associated protein 97
    Species: Rattus norvegicus [TaxId:10116]
    Gene: DLG1_RAT
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q62696
      • see remark 999 (3-4)
      • see remark 999 (88)
    Domains in SCOPe 2.08: d2g2la_
  • Chain 'B':
    Compound: Synapse-associated protein 97
    Species: Rattus norvegicus [TaxId:10116]
    Gene: DLG1_RAT
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q62696
      • see remark 999 (3-4)
      • see remark 999 (88)
    Domains in SCOPe 2.08: d2g2lb_
  • Chain 'C':
    Compound: 18-mer peptide from glutamate receptor, ionotropic, AMPA1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • GB NP_113796 (Start-17)
  • Chain 'D':
    Compound: 18-mer peptide from glutamate receptor, ionotropic, AMPA1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • GB NP_113796 (Start-17)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2g2lA (A:)
    mekimeiklikgpkglgfsiaggvgnqhipgdnsiyvtkiieggaahkdgklqigdklla
    vnsvcleevtheeavtalkntsdfvylkvakptsmyisrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g2lA (A:)
    kimeiklikgpkglgfsiaggvgnqhipgdnsiyvtkiieggaahkdgklqigdkllavn
    svcleevtheeavtalkntsdfvylkvakp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2g2lB (B:)
    mekimeiklikgpkglgfsiaggvgnqhipgdnsiyvtkiieggaahkdgklqigdklla
    vnsvcleevtheeavtalkntsdfvylkvakptsmyisrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g2lB (B:)
    kimeiklikgpkglgfsiaggvgnqhipgdnsiyvtkiieggaahkdgklqigdkllavn
    svcleevtheeavtalkntsdfvylkvakp
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.