PDB entry 2g2l
View 2g2l on RCSB PDB site
Description: Crystal Structure of the Second PDZ Domain of SAP97 in Complex with a GluR-A C-terminal Peptide
Class: membrane protein
Keywords: membrane protein, synaptic signaling, trafficking protein
Deposited on
2006-02-16, released
2006-08-29
The last revision prior to the SCOPe 2.08 freeze date was dated
2017-10-18, with a file datestamp of
2017-10-13.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.23
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Synapse-associated protein 97
Species: Rattus norvegicus [TaxId:10116]
Gene: DLG1_RAT
Database cross-references and differences (RAF-indexed):
- Uniprot Q62696
- see remark 999 (3-4)
- see remark 999 (88)
Domains in SCOPe 2.08: d2g2la_ - Chain 'B':
Compound: Synapse-associated protein 97
Species: Rattus norvegicus [TaxId:10116]
Gene: DLG1_RAT
Database cross-references and differences (RAF-indexed):
- Uniprot Q62696
- see remark 999 (3-4)
- see remark 999 (88)
Domains in SCOPe 2.08: d2g2lb_ - Chain 'C':
Compound: 18-mer peptide from glutamate receptor, ionotropic, AMPA1
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: 18-mer peptide from glutamate receptor, ionotropic, AMPA1
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2g2lA (A:)
mekimeiklikgpkglgfsiaggvgnqhipgdnsiyvtkiieggaahkdgklqigdklla
vnsvcleevtheeavtalkntsdfvylkvakptsmyisrhhhhhh
Sequence, based on observed residues (ATOM records): (download)
>2g2lA (A:)
kimeiklikgpkglgfsiaggvgnqhipgdnsiyvtkiieggaahkdgklqigdkllavn
svcleevtheeavtalkntsdfvylkvakp
- Chain 'B':
Sequence, based on SEQRES records: (download)
>2g2lB (B:)
mekimeiklikgpkglgfsiaggvgnqhipgdnsiyvtkiieggaahkdgklqigdklla
vnsvcleevtheeavtalkntsdfvylkvakptsmyisrhhhhhh
Sequence, based on observed residues (ATOM records): (download)
>2g2lB (B:)
kimeiklikgpkglgfsiaggvgnqhipgdnsiyvtkiieggaahkdgklqigdkllavn
svcleevtheeavtalkntsdfvylkvakp
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.