PDB entry 2g2h

View 2g2h on RCSB PDB site
Description: A Src-like Inactive Conformation in the Abl Tyrosine Kinase Domain
Class: transferase
Keywords: Protein Kinase, TRANSFERASE
Deposited on 2006-02-16, released 2006-05-23
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.193
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Abl Tyrosine
    Species: Homo sapiens [TaxId:9606]
    Gene: ABL1, ABL, JTK7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00519
      • engineered (170)
    Domains in SCOPe 2.04: d2g2ha_
  • Chain 'B':
    Compound: Abl Tyrosine
    Species: Homo sapiens [TaxId:9606]
    Gene: ABL1, ABL, JTK7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00519
      • engineered (170)
    Domains in SCOPe 2.04: d2g2hb_
  • Heterogens: P16, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2g2hA (A:)
    ghmspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflk
    eaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllymat
    qissameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytapagakfpikw
    tapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcp
    ekvyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g2hA (A:)
    dkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaavmke
    ikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllymatqissame
    ylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytapagakfpikwtapesla
    ynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyelm
    racwqwnpsdrpsfaeihqafetmfqessisd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2g2hB (B:)
    ghmspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflk
    eaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllymat
    qissameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytapagakfpikw
    tapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcp
    ekvyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g2hB (B:)
    dkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaavmke
    ikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllymatqissame
    ylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytapagakfpikwtapesla
    ynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyelm
    racwqwnpsdrpsfaeihqafetmfqessisd