PDB entry 2g2d

View 2g2d on RCSB PDB site
Description: Crystal structure of a putative pduO-type ATP:cobalamin adenosyltransferase from Mycobacterium tuberculosis
Class: transferase
Keywords: helix bundle, trimer, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, TRANSFERASE
Deposited on 2006-02-15, released 2006-03-28
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.194
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP:cobalamin adenosyltransferase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2g2da_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2g2dA (A:)
    mavhltriytrtgddgttglsdmsrvaktdarlvayadcdeanaaigaalalghpdtqit
    dvlrqiqndlfdagadlstpivenpkhpplriaqsyidrlegwcdaynaglpalksfvlp
    ggsplsallhvartvvrraersawaavdahpegvsvlpakylnrlsdllfilsrvanpdg
    dvlwrpggdrtas
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g2dA (A:)
    tdarlvayadcdeanaaigaalalghpdtqitdvlrqiqndlfdagadlstpivenpkhp
    plriaqsyidrlegwcdaynaglpalksfvlpggsplsallhvartvvrraersawaavd
    ahpegvsvlpakylnrlsdllfilsrvanpdgdvlwrpgg