PDB entry 2g2c

View 2g2c on RCSB PDB site
Description: Putative molybdenum cofactor biosynthesis protein from Corynebacterium diphtheriae.
Class: structural genomics, unknown function
Keywords: structural genomics, putative molybdenum cofactor biosynthesis protein, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2006-02-15, released 2006-03-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.174
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative molybdenum cofactor biosynthesis protein
    Species: Corynebacterium diphtheriae [TaxId:1717]
    Gene: DIP0503
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6NJA6 (3-End)
      • modified residue (3)
      • modified residue (33)
    Domains in SCOPe 2.08: d2g2ca1
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2g2cA (A:)
snamhiksaiivvsdristgtrenkalpllqrlmsdelqdysyelisevvvpegydtvve
aiatalkqgarfiitaggtgiraknqtpeatasfihtrcegleqqilihgsththlagls
rgivgvtgrddhaalivnapsssggitdtwavispvipnifegldas

    Sequence, based on observed residues (ATOM records): (download) 
    >2g2cA (A:)
mhiksaiivvsdristgtrenkalpllqrlmsdysyelisevvvpegydtvveaiatalk
qgarfiitaggtgiraknqtpeatasfihtrcegleqqilihgglsrgivgvtgrddhaa
livnapsssggitdtwavispvipnifeglda