PDB entry 2g28

View 2g28 on RCSB PDB site
Description: E. Coli Pyruvate Dehydrogenase H407A variant Phosphonolactylthiamin Diphosphate Complex
Class: oxidoreductase
Keywords: plthdp, phosphonolactylthiamin diphosphate, pyruvate dehydrogenase e1 component, oxidoreductase
Deposited on 2006-02-15, released 2006-04-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.216
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyruvate dehydrogenase E1 component
    Species: Escherichia coli [TaxId:562]
    Gene: aceE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2g28a1, d2g28a2, d2g28a3
  • Chain 'B':
    Compound: Pyruvate dehydrogenase E1 component
    Species: Escherichia coli [TaxId:562]
    Gene: aceE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2g28b1, d2g28b2, d2g28b3
  • Heterogens: MG, TDK, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2g28A (A:)
    serfpndvdpietrdwlqaiesvireegveraqylidqllaearkggvnvaagtgisnyi
    ntipveeqpeypgnlelerrirsairwnaimtvlraskkdlelgghmasfqssatiydvc
    fnhffrarneqdggdlvyfqghispgvyaraflegrltqeqldnfrqevhgnglssyphp
    klmpefwqfptvsmglgpigaiyqakflkylehrglkdtskqtvyaflgdgemdepeskg
    aitiatrekldnlvfvincnlqrldgpvtgngkiinelegifegagwnvikvmwgsrwde
    llrkdtsgkliqlmnetvdgdyqtfkskdgayvrehffgkypetaalvadwtdeqiwaln
    rgghdpkkiyaafkkaqetkgkatvilahtikgygmgdaaegkniahqvkkmnmdgvrhi
    rdrfnvpvsdadieklpyitfpegseehtylhaqrqklhgylpsrqpnfteklelpslqd
    fgalleeqskeisttiafvralnvmlknksikdrlvpiiadeartfgmeglfrqigiysp
    ngqqytpqdreqvayykedekgqilqeginelgagcswlaaatsystnnlpmipfyiyys
    mfgfqrigdlcwaagdqqargfliggtsgrttlngeglqhedghshiqsltipncisydp
    ayayevavimhdglermygekqenvyyyittlnenyhmpampegaeegirkgiykletie
    gskgkvqllgsgsilrhvreaaeilakdygvgsdvysvtsftelardgqdcerwnmlhpl
    etprvpyiaqvmndapavastdymklfaeqvrtyvpaddyrvlgtdgfgrsdsrenlrhh
    fevdasyvvvaalgelakrgeidkkvvadaiakfnidadkvnprla
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g28A (A:)
    isnyintipveeqpeypgnlelerrirsairwnaimtvlraskkdlelgghmasfqssat
    iydvcfnhffrarneqdggdlvyfqghispgvyaraflegrltqeqldnfrqevhgngls
    syphpklmpefwqfptvsmglgpigaiyqakflkylehrglkdtskqtvyaflgdgemde
    peskgaitiatrekldnlvfvincnlqrldgpvtgngkiinelegifegagwnvikvmwg
    srwdellrkdtsgkliqlmnetvdgdyqtfkskdgayvrehffgkypetaalvadwtdeq
    iwalnrgghdpkkiyaafkkaqetkgkatvilahtikgygmgdaamdgvrhirdrfnvpv
    sdadieklpyitfpegseehtylhaqrqklhgylpsrqpnfteklelpslqdfgalleeq
    skeisttiafvralnvmlknksikdrlvpiiadeartfgmeglfrqigiyspedekgqil
    qeginelgagcswlaaatsystnnlpmipfyiyysmfgfqrigdlcwaagdqqargflig
    gtsgrttlngeglqhedghshiqsltipncisydpayayevavimhdglermygekqenv
    yyyittlnenyhmpampegaeegirkgiykletiegskgkvqllgsgsilrhvreaaeil
    akdygvgsdvysvtsftelardgqdcerwnmlhpletprvpyiaqvmndapavastdymk
    lfaeqvrtyvpaddyrvlgtdgfgrsdsrenlrhhfevdasyvvvaalgelakrgeidkk
    vvadaiakfnidadkvnprla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2g28B (B:)
    serfpndvdpietrdwlqaiesvireegveraqylidqllaearkggvnvaagtgisnyi
    ntipveeqpeypgnlelerrirsairwnaimtvlraskkdlelgghmasfqssatiydvc
    fnhffrarneqdggdlvyfqghispgvyaraflegrltqeqldnfrqevhgnglssyphp
    klmpefwqfptvsmglgpigaiyqakflkylehrglkdtskqtvyaflgdgemdepeskg
    aitiatrekldnlvfvincnlqrldgpvtgngkiinelegifegagwnvikvmwgsrwde
    llrkdtsgkliqlmnetvdgdyqtfkskdgayvrehffgkypetaalvadwtdeqiwaln
    rgghdpkkiyaafkkaqetkgkatvilahtikgygmgdaaegkniahqvkkmnmdgvrhi
    rdrfnvpvsdadieklpyitfpegseehtylhaqrqklhgylpsrqpnfteklelpslqd
    fgalleeqskeisttiafvralnvmlknksikdrlvpiiadeartfgmeglfrqigiysp
    ngqqytpqdreqvayykedekgqilqeginelgagcswlaaatsystnnlpmipfyiyys
    mfgfqrigdlcwaagdqqargfliggtsgrttlngeglqhedghshiqsltipncisydp
    ayayevavimhdglermygekqenvyyyittlnenyhmpampegaeegirkgiykletie
    gskgkvqllgsgsilrhvreaaeilakdygvgsdvysvtsftelardgqdcerwnmlhpl
    etprvpyiaqvmndapavastdymklfaeqvrtyvpaddyrvlgtdgfgrsdsrenlrhh
    fevdasyvvvaalgelakrgeidkkvvadaiakfnidadkvnprla
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g28B (B:)
    isnyintipveeqpeypgnlelerrirsairwnaimtvlraskkdlelgghmasfqssat
    iydvcfnhffrarneqdggdlvyfqghispgvyaraflegrltqeqldnfrqevhgngls
    syphpklmpefwqfptvsmglgpigaiyqakflkylehrglkdtskqtvyaflgdgemde
    peskgaitiatrekldnlvfvincnlqrldgpvtgngkiinelegifegagwnvikvmwg
    srwdellrkdtsgkliqlmnetvdgdyqtfkskdgayvrehffgkypetaalvadwtdeq
    iwalnrgghdpkkiyaafkkaqetkgkatvilahtikgygmgdaamdgvrhirdrfnvpv
    sdadieklpyitfpegseehtylhaqrqklhgylpsrqpnfteklelpslqdfgalleeq
    skeisttiafvralnvmlknksikdrlvpiiadeartfgmeglfrqigiyspedekgqil
    qeginelgagcswlaaatsystnnlpmipfyiyysmfgfqrigdlcwaagdqqargflig
    gtsgrttlngeglqhedghshiqsltipncisydpayayevavimhdglermygekqenv
    yyyittlnenyhmpampegaeegirkgiykletiegskgkvqllgsgsilrhvreaaeil
    akdygvgsdvysvtsftelardgqdcerwnmlhpletprvpyiaqvmndapavastdymk
    lfaeqvrtyvpaddyrvlgtdgfgrsdsrenlrhhfevdasyvvvaalgelakrgeidkk
    vvadaiakfnidadkvnprla