PDB entry 2g25

View 2g25 on RCSB PDB site
Description: E. Coli Pyruvate Dehydrogenase Phosphonolactylthiamin Diphosphate Complex
Class: oxidoreductase
Keywords: plthdp, phosphonolactylthiamin diphosphate, pyruvate dehydrogenase e1 component, oxidoreductase
Deposited on 2006-02-15, released 2006-04-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyruvate dehydrogenase E1 component
    Species: Escherichia coli [TaxId:562]
    Gene: aceE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2g25a1, d2g25a2, d2g25a3
  • Chain 'B':
    Compound: Pyruvate dehydrogenase E1 component
    Species: Escherichia coli [TaxId:562]
    Gene: aceE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2g25b1, d2g25b2, d2g25b3
  • Heterogens: MG, PO4, TDK, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2g25A (A:)
    serfpndvdpietrdwlqaiesvireegveraqylidqllaearkggvnvaagtgisnyi
    ntipveeqpeypgnlelerrirsairwnaimtvlraskkdlelgghmasfqssatiydvc
    fnhffrarneqdggdlvyfqghispgvyaraflegrltqeqldnfrqevhgnglssyphp
    klmpefwqfptvsmglgpigaiyqakflkylehrglkdtskqtvyaflgdgemdepeskg
    aitiatrekldnlvfvincnlqrldgpvtgngkiinelegifegagwnvikvmwgsrwde
    llrkdtsgkliqlmnetvdgdyqtfkskdgayvrehffgkypetaalvadwtdeqiwaln
    rgghdpkkiyaafkkaqetkgkatvilahtikgygmgdaaegkniahqvkkmnmdgvrhi
    rdrfnvpvsdadieklpyitfpegseehtylhaqrqklhgylpsrqpnfteklelpslqd
    fgalleeqskeisttiafvralnvmlknksikdrlvpiiadeartfgmeglfrqigiysp
    ngqqytpqdreqvayykedekgqilqeginelgagcswlaaatsystnnlpmipfyiyys
    mfgfqrigdlcwaagdqqargfliggtsgrttlngeglqhedghshiqsltipncisydp
    ayayevavimhdglermygekqenvyyyittlnenyhmpampegaeegirkgiykletie
    gskgkvqllgsgsilrhvreaaeilakdygvgsdvysvtsftelardgqdcerwnmlhpl
    etprvpyiaqvmndapavastdymklfaeqvrtyvpaddyrvlgtdgfgrsdsrenlrhh
    fevdasyvvvaalgelakrgeidkkvvadaiakfnidadkvnprla
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g25A (A:)
    isnyintipveeqpeypgnlelerrirsairwnaimtvlraskkdlelgghmasfqssat
    iydvcfnhffrarneqdggdlvyfqghispgvyaraflegrltqeqldnfrqevhgngls
    syphpklmpefwqfptvsmglgpigaiyqakflkylehrglkdtskqtvyaflgdgemde
    peskgaitiatrekldnlvfvincnlqrldgpvtgngkiinelegifegagwnvikvmwg
    srwdellrkdtsgkliqlmnetvdgdyqtfkskdgayvrehffgkypetaalvadwtdeq
    iwalnrgghdpkkiyaafkkaqetkgkatvilahtikgygmgdaaegkniahqvkkmnmd
    gvrhirdrfnvpvsdadieklpyitfpegseehtylhaqrqklhgylpsrqpnfteklel
    pslqdfgalleeqskeisttiafvralnvmlknksikdrlvpiiadeartfgmeglfrqi
    giyspngqqytpqdreqvayykedekgqilqeginelgagcswlaaatsystnnlpmipf
    yiyysmfgfqrigdlcwaagdqqargfliggtsgrttlngeglqhedghshiqsltipnc
    isydpayayevavimhdglermygekqenvyyyittlnenyhmpampegaeegirkgiyk
    letiegskgkvqllgsgsilrhvreaaeilakdygvgsdvysvtsftelardgqdcerwn
    mlhpletprvpyiaqvmndapavastdymklfaeqvrtyvpaddyrvlgtdgfgrsdsre
    nlrhhfevdasyvvvaalgelakrgeidkkvvadaiakfnidadkvnprla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2g25B (B:)
    serfpndvdpietrdwlqaiesvireegveraqylidqllaearkggvnvaagtgisnyi
    ntipveeqpeypgnlelerrirsairwnaimtvlraskkdlelgghmasfqssatiydvc
    fnhffrarneqdggdlvyfqghispgvyaraflegrltqeqldnfrqevhgnglssyphp
    klmpefwqfptvsmglgpigaiyqakflkylehrglkdtskqtvyaflgdgemdepeskg
    aitiatrekldnlvfvincnlqrldgpvtgngkiinelegifegagwnvikvmwgsrwde
    llrkdtsgkliqlmnetvdgdyqtfkskdgayvrehffgkypetaalvadwtdeqiwaln
    rgghdpkkiyaafkkaqetkgkatvilahtikgygmgdaaegkniahqvkkmnmdgvrhi
    rdrfnvpvsdadieklpyitfpegseehtylhaqrqklhgylpsrqpnfteklelpslqd
    fgalleeqskeisttiafvralnvmlknksikdrlvpiiadeartfgmeglfrqigiysp
    ngqqytpqdreqvayykedekgqilqeginelgagcswlaaatsystnnlpmipfyiyys
    mfgfqrigdlcwaagdqqargfliggtsgrttlngeglqhedghshiqsltipncisydp
    ayayevavimhdglermygekqenvyyyittlnenyhmpampegaeegirkgiykletie
    gskgkvqllgsgsilrhvreaaeilakdygvgsdvysvtsftelardgqdcerwnmlhpl
    etprvpyiaqvmndapavastdymklfaeqvrtyvpaddyrvlgtdgfgrsdsrenlrhh
    fevdasyvvvaalgelakrgeidkkvvadaiakfnidadkvnprla
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g25B (B:)
    isnyintipveeqpeypgnlelerrirsairwnaimtvlraskkdlelgghmasfqssat
    iydvcfnhffrarneqdggdlvyfqghispgvyaraflegrltqeqldnfrqevhgngls
    syphpklmpefwqfptvsmglgpigaiyqakflkylehrglkdtskqtvyaflgdgemde
    peskgaitiatrekldnlvfvincnlqrldgpvtgngkiinelegifegagwnvikvmwg
    srwdellrkdtsgkliqlmnetvdgdyqtfkskdgayvrehffgkypetaalvadwtdeq
    iwalnrgghdpkkiyaafkkaqetkgkatvilahtikgygmgdaaegkniahqvkkmnmd
    gvrhirdrfnvpvsdadieklpyitfpegseehtylhaqrqklhgylpsrqpnfteklel
    pslqdfgalleeqskeisttiafvralnvmlknksikdrlvpiiadeartfgmeglfrqi
    giyspngqqytpqdreqvayykedekgqilqeginelgagcswlaaatsystnnlpmipf
    yiyysmfgfqrigdlcwaagdqqargfliggtsgrttlngeglqhedghshiqsltipnc
    isydpayayevavimhdglermygekqenvyyyittlnenyhmpampegaeegirkgiyk
    letiegskgkvqllgsgsilrhvreaaeilakdygvgsdvysvtsftelardgqdcerwn
    mlhpletprvpyiaqvmndapavastdymklfaeqvrtyvpaddyrvlgtdgfgrsdsre
    nlrhhfevdasyvvvaalgelakrgeidkkvvadaiakfnidadkvnprla