PDB entry 2g20

View 2g20 on RCSB PDB site
Description: Ketopiperazine-Based Renin Inhibitors: Optimization of the C Ring
Class: hydrolase
Keywords: protein-ligand complexes, hydrolase
Deposited on 2006-02-15, released 2006-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.21
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: renin
    Species: Homo sapiens [TaxId:9606]
    Gene: REN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2g20a_
  • Chain 'B':
    Compound: renin
    Species: Homo sapiens [TaxId:9606]
    Gene: REN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2g20b_
  • Heterogens: L1A, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2g20A (A:)
    ssviltnymdtqyygeigigtppqtfkvvfdtgssnvwvpsskcsrlytacvyhklfdas
    dsssykhngteltlrystgtvsgflsqdiitvggitvtqmfgevtempalpfmlaefdgv
    vgmgfieqaigrvtpifdniisqgvlkedvfsfyynrdsensqslggqivlggsdpqhye
    gnfhyinliktgvwqiqmkgvsvgsstllcedgclalvdtgasyisgstssieklmealg
    akkrlfdyvvkcnegptlpdisfhlggkeytltsadyvfqesysskklctlaihamdipp
    ptgptwalgatfirkfytefdrrnnrigfalar
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2g20B (B:)
    ssviltnymdtqyygeigigtppqtfkvvfdtgssnvwvpsskcsrlytacvyhklfdas
    dsssykhngteltlrystgtvsgflsqdiitvggitvtqmfgevtempalpfmlaefdgv
    vgmgfieqaigrvtpifdniisqgvlkedvfsfyynrdsensqslggqivlggsdpqhye
    gnfhyinliktgvwqiqmkgvsvgsstllcedgclalvdtgasyisgstssieklmealg
    akkrlfdyvvkcnegptlpdisfhlggkeytltsadyvfqesysskklctlaihamdipp
    ptgptwalgatfirkfytefdrrnnrigfalar