PDB entry 2g1q

View 2g1q on RCSB PDB site
Description: crystal structure of KSP in complex with inhibitor 9h
Class: cell cycle
Keywords: KSP, KSP-inhibitor complex, CELL CYCLE
Deposited on 2006-02-14, released 2006-10-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.51 Å
R-factor: 0.234
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kinesin-like protein KIF11
    Species: Homo sapiens [TaxId:9606]
    Gene: KIF11, EG5, KNSL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2g1qa_
  • Chain 'B':
    Compound: Kinesin-like protein KIF11
    Species: Homo sapiens [TaxId:9606]
    Gene: KIF11, EG5, KNSL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2g1qb_
  • Heterogens: MG, ADP, N9H, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2g1qA (A:)
    masqpnssakkkeekgkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladk
    ssrktytfdmvfgastkqidvyrsvvcpildevimgynctifaygqtgtgktftmegers
    pneeytweedplagiiprtlhqifekltdngtefsvkvslleiyneelfdllnpssdvse
    rlqmfddprnkrgviikgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfs
    vtihmkettidgeelvkigklnlvdlagsenigrsgavdkrareagninqslltlgrvit
    alvertphvpyreskltrilqdslggrtrtsiiatispaslnleetlstleyahraknil
    nkpevnqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g1qA (A:)
    niqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladkssrktytfdmvfgastk
    qidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagiip
    rtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgviik
    gleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkettidgeelvk
    igklnlvdlagsenninqslltlgrvitalvertphvpyreskltrilqdslggrtrtsi
    iatispaslnleetlstleyahraknilnk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2g1qB (B:)
    masqpnssakkkeekgkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladk
    ssrktytfdmvfgastkqidvyrsvvcpildevimgynctifaygqtgtgktftmegers
    pneeytweedplagiiprtlhqifekltdngtefsvkvslleiyneelfdllnpssdvse
    rlqmfddprnkrgviikgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfs
    vtihmkettidgeelvkigklnlvdlagsenigrsgavdkrareagninqslltlgrvit
    alvertphvpyreskltrilqdslggrtrtsiiatispaslnleetlstleyahraknil
    nkpevnqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g1qB (B:)
    niqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladkssrktytfdmvfgastk
    qidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagiip
    rtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgviik
    gleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkettidgeelvk
    igklnlvdlagsenninqslltlgrvitalvertphvpyreskltrilqdslggrtrtsi
    iatispaslnleetlstleyahraknilnk