PDB entry 2g1l

View 2g1l on RCSB PDB site
Description: Crystal structure of the FHA domain of human kinesin family member C
Class: transport protein
Keywords: transport, FHA domain, structural genomics consortium, kinesin, SGC
Deposited on 2006-02-14, released 2006-02-28
The last revision prior to the SCOP 1.73 freeze date was dated 2006-02-28, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.216
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kinesin-like protein KIF1C
    Species: HOMO SAPIENS
    Gene: KIF1C, KIAA0706
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43896 (2-103)
      • cloning artifact (1)
    Domains in SCOP 1.73: d2g1la1
  • Heterogens: CL, NI, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2g1lA (A:)
    gstphlvnlnedplmsecllyhikdgvtrvgqvdmdikltgqfireqhclfrsipqpdge
    vvvtlepcegaetyvngklvteplvlksgnrivmgknhvfrfnh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g1lA (A:)
    stphlvnlnedplmsecllyhikdgvtrvgqvdmdikltgqfireqhclfrsipqpdgev
    vvtlepcegaetyvngklvteplvlksgnrivmgknhvfrfnh