PDB entry 2g1k

View 2g1k on RCSB PDB site
Description: Crystal structure of Mycobacterium tuberculosis shikimate kinase in complex with shikimate at 1.75 angstrom resolution
Class: transferase
Keywords: shikimate pathway, shikimate kinase, ternary complex, drug design
Deposited on 2006-02-14, released 2006-07-18
The last revision prior to the SCOP 1.73 freeze date was dated 2006-07-18, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.222
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Shikimate kinase
    Species: Mycobacterium tuberculosis
    Gene: AroK
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2g1ka1
  • Heterogens: SO4, CL, SKM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2g1kA (A:)
    mapkavlvglpgsgkstigrrlakalgvglldtdvaieqrtgrsiadifatdgeqefrri
    eedvvraaladhdgvlslgggavtspgvraalaghtvvyleisaaegvrrtggntvrpll
    agpdraekyralmakraplyrrvatmrvdtnrrnpgavvrhilsrlqvpspseaat
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g1kA (A:)
    apkavlvglpgsgkstigrrlakalgvglldtdvaieqrtgrsiadifatdgeqefrrie
    edvvraaladhdgvlslgggavtspgvraalaghtvvyleisaaegvrrtggntvrplla
    gpdraekyralmakraplyrrvatmrvdtnrrnpgavvrhilsrlqvp