PDB entry 2g1k

View 2g1k on RCSB PDB site
Description: Crystal structure of Mycobacterium tuberculosis shikimate kinase in complex with shikimate at 1.75 angstrom resolution
Class: transferase
Keywords: shikimate pathway, shikimate kinase, ternary complex, drug design, TRANSFERASE
Deposited on 2006-02-14, released 2006-07-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.222
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Shikimate kinase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: AroK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2g1ka_
  • Heterogens: SO4, CL, SKM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2g1kA (A:)
    mapkavlvglpgsgkstigrrlakalgvglldtdvaieqrtgrsiadifatdgeqefrri
    eedvvraaladhdgvlslgggavtspgvraalaghtvvyleisaaegvrrtggntvrpll
    agpdraekyralmakraplyrrvatmrvdtnrrnpgavvrhilsrlqvpspseaat
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g1kA (A:)
    apkavlvglpgsgkstigrrlakalgvglldtdvaieqrtgrsiadifatdgeqefrrie
    edvvraaladhdgvlslgggavtspgvraalaghtvvyleisaaegvrrtggntvrplla
    gpdraekyralmakraplyrrvatmrvdtnrrnpgavvrhilsrlqvp