PDB entry 2g1i

View 2g1i on RCSB PDB site
Description: Crystal Structure of Pyruvate Decarboxylase from Kluyveromyces lactis
Class: Lyase
Keywords: dimer of dimers, asymmetric active sites, substrate activation, Lyase
Deposited on 2006-02-14, released 2006-09-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-01-27, with a file datestamp of 2009-01-23.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: 0.159
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyruvate decarboxylase
    Species: KLUYVEROMYCES LACTIS [TaxId:28985]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2g1ia1, d2g1ia2, d2g1ia3
  • Chain 'B':
    Compound: pyruvate decarboxylase
    Species: KLUYVEROMYCES LACTIS [TaxId:28985]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2g1ib1, d2g1ib2, d2g1ib3
  • Chain 'C':
    Compound: pyruvate decarboxylase
    Species: KLUYVEROMYCES LACTIS [TaxId:28985]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2g1ic1, d2g1ic2, d2g1ic3
  • Chain 'D':
    Compound: pyruvate decarboxylase
    Species: KLUYVEROMYCES LACTIS [TaxId:28985]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2g1id1, d2g1id2, d2g1id3
  • Heterogens: MG, TPP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2g1iA (A:)
    mseitlgrylferlkqvevqtifglpgdfnlslldniyevpgmrwagnanelnaayaadg
    yarlkgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsvssqakqlllhhtlgng
    dftvfhrmssnisettamitdintapaeidrcirttyvsqrpvylglpanlvdltvpasl
    ldtpidlslkpndpeaeeevienvlqlikeaknpviladaccsrhdakaetkklidltqf
    pafvtpmgkgsidekhprfggvyvgtlsspavkeavesadlvlsvgallsdfntgsfsys
    yktknivefhsdytkirsatfpgvqmkfalqklltkvadaakgykpvpvpsepehneava
    dstplkqewvwtqvgeflregdvvitetgtsafginqthfpnntygisqvlwgsigfttg
    atlgaafaaeeidpkkrvilfigdgslqltvqeistmirwglkpylfvlnndgytierli
    hgetaqynciqnwqhlellptfgakdyeavrvsttgewnklttdekfqdntrirlievml
    ptmdapsnlvkqaqltaatnakn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g1iA (A:)
    seitlgrylferlkqvevqtifglpgdfnlslldniyevpgmrwagnanelnaayaadgy
    arlkgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsvshhtlgngdftvfhrms
    snisettamitdintapaeidrcirttyvsqrpvylglpanlvdltvpaslldtpidlsl
    kpndpeaeeevienvlqlikeaknpviladaccsrhdakaetkklidltqfpafvtpmgk
    gsidekhprfggvyvgtlsspavkeavesadlvlsvgalltknivefhsdytkirsatfp
    gvqmkfalqklltkvadaakgykpvpvpsepehneavadstplkqewvwtqvgeflregd
    vvitetgtsafginqthfpnntygisqvlwgsigfttgatlgaafaaeeidpkkrvilfi
    gdgslqltvqeistmirwglkpylfvlnndgytierlihgetaqynciqnwqhlellptf
    gakdyeavrvsttgewnklttdekfqdntrirlievmlptmdapsnlvkqaqltaatnak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2g1iB (B:)
    mseitlgrylferlkqvevqtifglpgdfnlslldniyevpgmrwagnanelnaayaadg
    yarlkgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsvssqakqlllhhtlgng
    dftvfhrmssnisettamitdintapaeidrcirttyvsqrpvylglpanlvdltvpasl
    ldtpidlslkpndpeaeeevienvlqlikeaknpviladaccsrhdakaetkklidltqf
    pafvtpmgkgsidekhprfggvyvgtlsspavkeavesadlvlsvgallsdfntgsfsys
    yktknivefhsdytkirsatfpgvqmkfalqklltkvadaakgykpvpvpsepehneava
    dstplkqewvwtqvgeflregdvvitetgtsafginqthfpnntygisqvlwgsigfttg
    atlgaafaaeeidpkkrvilfigdgslqltvqeistmirwglkpylfvlnndgytierli
    hgetaqynciqnwqhlellptfgakdyeavrvsttgewnklttdekfqdntrirlievml
    ptmdapsnlvkqaqltaatnakn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g1iB (B:)
    seitlgrylferlkqvevqtifglpgdfnlslldniyevpgmrwagnanelnaayaadgy
    arlkgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsvhhtlgngdftvfhrmss
    nisettamitdintapaeidrcirttyvsqrpvylglpanlvdltvpaslldtpidlslk
    pndpeaeeevienvlqlikeaknpviladaccsrhdakaetkklidltqfpafvtpmgkg
    sidekhprfggvyvgtlsspavkeavesadlvlsvgallsdfntgsfsysyktknivefh
    sdytkirsatfpgvqmkfalqklltkvadaakgykpvpvpsepehneavadstplkqewv
    wtqvgeflregdvvitetgtsafginqthfpnntygisqvlwgsigfttgatlgaafaae
    eidpkkrvilfigdgslqltvqeistmirwglkpylfvlnndgytierlihgetaqynci
    qnwqhlellptfgakdyeavrvsttgewnklttdekfqdntrirlievmlptmdapsnlv
    kqaq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2g1iC (C:)
    mseitlgrylferlkqvevqtifglpgdfnlslldniyevpgmrwagnanelnaayaadg
    yarlkgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsvssqakqlllhhtlgng
    dftvfhrmssnisettamitdintapaeidrcirttyvsqrpvylglpanlvdltvpasl
    ldtpidlslkpndpeaeeevienvlqlikeaknpviladaccsrhdakaetkklidltqf
    pafvtpmgkgsidekhprfggvyvgtlsspavkeavesadlvlsvgallsdfntgsfsys
    yktknivefhsdytkirsatfpgvqmkfalqklltkvadaakgykpvpvpsepehneava
    dstplkqewvwtqvgeflregdvvitetgtsafginqthfpnntygisqvlwgsigfttg
    atlgaafaaeeidpkkrvilfigdgslqltvqeistmirwglkpylfvlnndgytierli
    hgetaqynciqnwqhlellptfgakdyeavrvsttgewnklttdekfqdntrirlievml
    ptmdapsnlvkqaqltaatnakn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g1iC (C:)
    seitlgrylferlkqvevqtifglpgdfnlslldniyevpgmrwagnanelnaayaadgy
    arlkgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsvtlgngdftvfhrmssni
    settamitdintapaeidrcirttyvsqrpvylglpanlvdltvpaslldtpidlslkpn
    dpeaeeevienvlqlikeaknpviladaccsrhdakaetkklidltqfpafvtpmgkgsi
    dekhprfggvyvgtlsspavkeavesadlvlsvgallsdfntgsfsysyktknivefhsd
    ytkirsatfpgvqmkfalqklltkvadaakgykpvpvpsepehneavadstplkqewvwt
    qvgeflregdvvitetgtsafginqthfpnntygisqvlwgsigfttgatlgaafaaeei
    dpkkrvilfigdgslqltvqeistmirwglkpylfvlnndgytierlihgetaqynciqn
    wqhlellptfgakdyeavrvsttgewnklttdekfqdntrirlievmlptmdapsnlvkq
    aqlt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2g1iD (D:)
    mseitlgrylferlkqvevqtifglpgdfnlslldniyevpgmrwagnanelnaayaadg
    yarlkgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsvssqakqlllhhtlgng
    dftvfhrmssnisettamitdintapaeidrcirttyvsqrpvylglpanlvdltvpasl
    ldtpidlslkpndpeaeeevienvlqlikeaknpviladaccsrhdakaetkklidltqf
    pafvtpmgkgsidekhprfggvyvgtlsspavkeavesadlvlsvgallsdfntgsfsys
    yktknivefhsdytkirsatfpgvqmkfalqklltkvadaakgykpvpvpsepehneava
    dstplkqewvwtqvgeflregdvvitetgtsafginqthfpnntygisqvlwgsigfttg
    atlgaafaaeeidpkkrvilfigdgslqltvqeistmirwglkpylfvlnndgytierli
    hgetaqynciqnwqhlellptfgakdyeavrvsttgewnklttdekfqdntrirlievml
    ptmdapsnlvkqaqltaatnakn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g1iD (D:)
    seitlgrylferlkqvevqtifglpgdfnlslldniyevpgmrwagnanelnaayaadgy
    arlkgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsvdftvfhrmssnisetta
    mitdintapaeidrcirttyvsqrpvylglpanlvdltvpaslldtpidlslkpndpeae
    eevienvlqlikeaknpviladaccsrhdakaetkklidltqfpafvtpmgkgsidekhp
    rfggvyvgtlsspavkeavesadlvlsvgallsdfntgsfsysyktknivefhsdytkir
    satfpgvqmkfalqklltkvadaakgykpvpvpsepehneavadstplkqewvwtqvgef
    lregdvvitetgtsafginqthfpnntygisqvlwgsigfttgatlgaafaaeeidpkkr
    vilfigdgslqltvqeistmirwglkpylfvlnndgytierlihgetaqynciqnwqhle
    llptfgakdyeavrvsttgewnklttdekfqdntrirlievmlptmdapsnlvkqaqlta
    atnak