PDB entry 2g17

View 2g17 on RCSB PDB site
Description: The structure of N-acetyl-gamma-glutamyl-phosphate reductase from Salmonella typhimurium.
Class: oxidoreductase
Keywords: N-acetyl-gamma-glutamyl-phosphate reductase, Semialdehyde dehydrogenase, NAD binding domain, amino acid transport metabolism, arginine biosynthesis, structural genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, OXIDOREDUCTASE
Deposited on 2006-02-13, released 2006-03-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.171
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-acetyl-gamma-glutamyl-phosphate reductase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: argC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZKL8 (3-336)
      • cloning artifact (0-2)
      • modified residue (3)
      • modified residue (29)
      • modified residue (65)
    Domains in SCOPe 2.05: d2g17a1, d2g17a2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2g17A (A:)
snamlntlivgasgyagaelvsyvnrhphmtitaltvsaqsndagklisdlhpqlkgivd
lplqpmsdvrdfsadvdvvflatahevshdlapqflqagcvvfdlsgafrvndrafyeky
ygfthqypelleqavyglaewnvdklntanliavpgcyptaaqlslkplidgglldltqw
pvinatsgvsgagrkaaisnsfcevslqpygvfthrhqpeiavhlgaeviftphlgnfpr
giletitcrlkagvthaqvadvlqkaygdkplvrlydkgvpalknvvglpfcdigfavqg
ehlivvatednllkgaaaqavqcanirfgfaetqsli