PDB entry 2g15

View 2g15 on RCSB PDB site
Description: Structural Characterization of autoinhibited c-Met kinase
Class: transferase
Keywords: Kinase domain, TRANSFERASE
Deposited on 2006-02-13, released 2006-03-21
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.234
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: activated met oncogene
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB AAB60323 (Start-317)
    Domains in SCOPe 2.04: d2g15a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2g15A (A:)
    mghhhhhhmgdsdisspllqntvhidlsalnpelvqavqhvvigpsslivhfnevigrgh
    fgcvyhgtlldndgkkihcavkslnritdigevsqfltegiimkdfshpnvlsllgiclr
    segsplvvlpymkhgdlrnfirnethnptvkdligfglqvakgmkylaskkfvhrdlaar
    ncmldekftvkvadfglardmydkeyysvhnktgaklpvkwmaleslqtqkfttksdvws
    fgvllwelmtrgappypdvntfditvyllqgrrllqpeycpdplyevmlkcwhpkaemrp
    sfselvsrisaifstfig
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g15A (A:)
    llqntvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkki
    hcavkslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdl
    rnfirnethnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfgl
    ardmydkeyysvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappyp
    dvntfditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfi
    g