PDB entry 2g0z

View 2g0z on RCSB PDB site
Description: Photolyzed CO L29F Myoglobin: 1ns
Class: transport protein
Keywords: Time-resolved crystallography; myoglobin; difference refinement; structure-function relationship; intermediate states, TRANSPORT PROTEIN
Deposited on 2006-02-13, released 2006-07-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-01-14, with a file datestamp of 2015-01-09.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.058
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (1-153)
      • initiating methionine (0)
      • engineered (29)
      • variant (122)
    Domains in SCOPe 2.06: d2g0za_
  • Heterogens: SO4, HEM, CMO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2g0zA (A:)
    mvlsegewqlvlhvwakveadvaghgqdifirlfkshpetlekfdrfkhlkteaemkase
    dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    pgnfgadaqgamnkalelfrkdiaakykelgyqg