PDB entry 2g0y

View 2g0y on RCSB PDB site
Description: Crystal Structure of a Lumenal Pentapeptide Repeat Protein from Cyanothece sp 51142 at 2.3 Angstrom Resolution. Tetragonal Crystal Form
Class: unknown function
Keywords: Right-Handed Beta Helix
Deposited on 2006-02-13, released 2006-11-07
The last revision prior to the SCOP 1.73 freeze date was dated 2006-11-07, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.233
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pentapeptide repeat protein
    Species: Cyanothece sp. ATCC 51142
    Domains in SCOP 1.73: d2g0ya1
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2g0yA (A:)
    mhhhhhhssglvprgsgmketaakferqhmdspdlgtddddkamamvtgssasyedvkli
    gedfsgksltyaqftnadltdsnfseadlrgavfngsaligadlhgadltnglayltsfk
    gadltnavlteaimmrtkfddakitgadfslavldvyevdklcdradgvnpktgvstres
    lrcq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g0yA (A:)
    sasyedvkligedfsgksltyaqftnadltdsnfseadlrgavfngsaligadlhgadlt
    nglayltsfkgadltnavlteaimmrtkfddakitgadfslavldvyevdklcdradgvn
    pktgvstreslrc