PDB entry 2g0u

View 2g0u on RCSB PDB site
Description: Solution Structure of Monomeric BsaL, the Type III Secretion Needle Protein of Burkholderia pseudomallei
Class: unknown function
Keywords: helix-turn-helix
Deposited on 2006-02-13, released 2006-05-23
The last revision prior to the SCOP 1.75 freeze date was dated 2006-05-23, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: type III secretion system needle protein
  Species: Burkholderia pseudomallei
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q63K18 (0-83)
    • conflict (9)
    • conflict (26)
    • conflict (33)
    • his tag (84-91)
  Domains in SCOP 1.75: d2g0ua1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2g0uA (A:)
  msnpptplladyewsgyltgigrafddgvkdlnkqlqdaqanltknpsdptalanyqmim
  seynlyrnaqssavksmkdidssilehhhhhh