PDB entry 2g0u

View 2g0u on RCSB PDB site
Description: Solution Structure of Monomeric BsaL, the Type III Secretion Needle Protein of Burkholderia pseudomallei
Class: unknown function
Keywords: helix-turn-helix
Deposited on 2006-02-13, released 2006-05-23
The last revision prior to the SCOP 1.73 freeze date was dated 2006-05-23, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: type III secretion system needle protein
    Species: Burkholderia pseudomallei
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q63K18 (0-83)
      • conflict (9)
      • conflict (26)
      • conflict (33)
      • his tag (84-91)
    Domains in SCOP 1.73: d2g0ua1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2g0uA (A:)
    msnpptplladyewsgyltgigrafddgvkdlnkqlqdaqanltknpsdptalanyqmim
    seynlyrnaqssavksmkdidssilehhhhhh