PDB entry 2g0u

View 2g0u on RCSB PDB site
Description: Solution Structure of Monomeric BsaL, the Type III Secretion Needle Protein of Burkholderia pseudomallei
Class: unknown function
Keywords: helix-turn-helix, UNKNOWN FUNCTION
Deposited on 2006-02-13, released 2006-05-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: type III secretion system needle protein
    Species: Burkholderia pseudomallei [TaxId:28450]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q63K18 (0-83)
      • conflict (9)
      • conflict (26)
      • conflict (33)
      • expression tag (84-91)
    Domains in SCOPe 2.08: d2g0ua1, d2g0ua2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2g0uA (A:)
    msnpptplladyewsgyltgigrafddgvkdlnkqlqdaqanltknpsdptalanyqmim
    seynlyrnaqssavksmkdidssilehhhhhh