PDB entry 2g0s

View 2g0s on RCSB PDB site
Description: Unphotolyzed CO-bound L29F Myoglobin, crystal 2
Class: transport protein
Keywords: Time-resolved crystallography; myoglobin; difference refinement; structure-function relationship; intermediate states, TRANSPORT PROTEIN
Deposited on 2006-02-13, released 2006-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (1-153)
      • initiating methionine (0)
      • engineered (29)
      • variant (122)
    Domains in SCOPe 2.07: d2g0sa_
  • Heterogens: SO4, HEM, CMO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2g0sA (A:)
    mvlsegewqlvlhvwakveadvaghgqdifirlfkshpetlekfdrfkhlkteaemkase
    dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    pgnfgadaqgamnkalelfrkdiaakykelgyqg