PDB entry 2g03

View 2g03 on RCSB PDB site
Description: Structure of a putative cell filamentation protein from Neisseria meningitidis.
Class: structural genomics, unknown function
Keywords: cell filamentation, cell division, chromosome partitioning, Fic protein family, structural genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2006-02-10, released 2006-03-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.185
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein NMA0004
    Species: Neisseria meningitidis [TaxId:122586]
    Gene: fic
    Database cross-references and differences (RAF-indexed):
    • GB CAB83324
      • modified residue (13)
      • modified residue (78)
      • modified residue (90)
      • modified residue (105)
      • modified residue (149)
    Domains in SCOPe 2.08: d2g03a1
  • Heterogens: IPA, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2g03A (A:)
snampsenpigktmksideqslhnarrlfesgdidrievgttaglqqihrylfgglydfa
gqiredniskggfrfanamylkealvkieqmpertfeeiiakyvemniahpflegngrst
riwldlvlkknlkkvvnwqnvsktlylqamerspvndlelrfllkdnltddvdnreiifk
gieqsyyyegyekg

    Sequence, based on observed residues (ATOM records): (download) 
    >2g03A (A:)
mksideqslhnarrlfesgdidrievgttaglqqihrylfgglydfagqiredniskggf
rfanamylkealvkieqmpertfeeiiakyvemniahpflegngrstriwldlvlkknlk
kvvnwqnvsktlylqamerspvndlelrfllkdnltddvdnreiifkgieqsyyyeg