PDB entry 2fzw

View 2fzw on RCSB PDB site
Description: Structure of the binary complex of the E67L mutant of human glutathione-dependent formaldehyde dehydrogenase with NAD(H)
Class: oxidoreductase
Keywords: s-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, OXIDOREDUCTASE
Deposited on 2006-02-10, released 2006-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alcohol dehydrogenase class III chi chain
    Species: Homo sapiens [TaxId:9606]
    Gene: ADH5, ADHX, FDH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11766 (0-372)
      • engineered (66)
    Domains in SCOPe 2.07: d2fzwa1, d2fzwa2
  • Chain 'B':
    Compound: Alcohol dehydrogenase class III chi chain
    Species: Homo sapiens [TaxId:9606]
    Gene: ADH5, ADHX, FDH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11766 (0-372)
      • engineered (66)
    Domains in SCOPe 2.07: d2fzwb1, d2fzwb2
  • Heterogens: ZN, PO4, K, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fzwA (A:)
    anevikckaavaweagkplsieeievappkahevrikiiatavchtdaytlsgadpegcf
    pvilghlgagivesvgegvtklkagdtviplyipqcgeckfclnpktnlcqkirvtqgkg
    lmpdgtsrftckgktilhymgtstfseytvvadisvakidplapldkvcllgcgistgyg
    aavntaklepgsvcavfglggvglavimgckvagasriigvdinkdkfarakefgateci
    npqdfskpiqevliemtdggvdysfecignvkvmraaleachkgwgvsvvvgvaasgeei
    atrpfqlvtgrtwkgtafggwksvesvpklvseymskkikvdefvthnlsfdeinkafel
    mhsgksirtvvki
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fzwB (B:)
    anevikckaavaweagkplsieeievappkahevrikiiatavchtdaytlsgadpegcf
    pvilghlgagivesvgegvtklkagdtviplyipqcgeckfclnpktnlcqkirvtqgkg
    lmpdgtsrftckgktilhymgtstfseytvvadisvakidplapldkvcllgcgistgyg
    aavntaklepgsvcavfglggvglavimgckvagasriigvdinkdkfarakefgateci
    npqdfskpiqevliemtdggvdysfecignvkvmraaleachkgwgvsvvvgvaasgeei
    atrpfqlvtgrtwkgtafggwksvesvpklvseymskkikvdefvthnlsfdeinkafel
    mhsgksirtvvki