SCOPe 2.08: Structural Classification of Proteins

PDB entry 2fzs

View 2fzs on RCSB PDB site
Description: Crystal structure of E. coli ClpP with a Peptide Chloromethyl Ketone Covalently Bound at the Active Site
Class: hydrolase
Keywords: ATP-dependent ClpP protease, Z-Leu-Tyr Chloromethyl Ketone Inhibitor, HYDROLASE
Deposited on 2006-02-10, released 2006-05-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.176
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli [TaxId:562]
Gene: clpP, lopP
Database cross-references and differences (RAF-indexed):
- Uniprot P0A6G7 (Start-192)
Domains in SCOPe 2.08: d2fzsa_
Chain 'B':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli [TaxId:562]
Gene: clpP, lopP
Database cross-references and differences (RAF-indexed):
- Uniprot P0A6G7 (Start-192)
Domains in SCOPe 2.08: d2fzsb_
Chain 'C':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli [TaxId:562]
Gene: clpP, lopP
Database cross-references and differences (RAF-indexed):
- Uniprot P0A6G7 (Start-192)
Domains in SCOPe 2.08: d2fzsc_
Chain 'D':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli [TaxId:562]
Gene: clpP, lopP
Database cross-references and differences (RAF-indexed):
- Uniprot P0A6G7 (Start-192)
Domains in SCOPe 2.08: d2fzsd_
Chain 'E':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli [TaxId:562]
Gene: clpP, lopP
Database cross-references and differences (RAF-indexed):
- Uniprot P0A6G7 (Start-192)
Domains in SCOPe 2.08: d2fzse_
Chain 'F':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli [TaxId:562]
Gene: clpP, lopP
Database cross-references and differences (RAF-indexed):
- Uniprot P0A6G7 (Start-192)
Domains in SCOPe 2.08: d2fzsf_
Chain 'G':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli [TaxId:562]
Gene: clpP, lopP
Database cross-references and differences (RAF-indexed):
- Uniprot P0A6G7 (Start-192)
Domains in SCOPe 2.08: d2fzsg_
Chain 'H':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli [TaxId:562]
Gene: clpP, lopP
Database cross-references and differences (RAF-indexed):
- Uniprot P0A6G7 (Start-192)
Domains in SCOPe 2.08: d2fzsh_
Chain 'I':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli [TaxId:562]
Gene: clpP, lopP
Database cross-references and differences (RAF-indexed):
- Uniprot P0A6G7 (Start-192)
Domains in SCOPe 2.08: d2fzsi_
Chain 'J':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli [TaxId:562]
Gene: clpP, lopP
Database cross-references and differences (RAF-indexed):
- Uniprot P0A6G7 (Start-192)
Domains in SCOPe 2.08: d2fzsj_
Chain 'K':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli [TaxId:562]
Gene: clpP, lopP
Database cross-references and differences (RAF-indexed):
- Uniprot P0A6G7 (Start-192)
Domains in SCOPe 2.08: d2fzsk_
Chain 'L':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli [TaxId:562]
Gene: clpP, lopP
Database cross-references and differences (RAF-indexed):
- Uniprot P0A6G7 (Start-192)
Domains in SCOPe 2.08: d2fzsl_
Chain 'M':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli [TaxId:562]
Gene: clpP, lopP
Database cross-references and differences (RAF-indexed):
- Uniprot P0A6G7 (0-192)
Domains in SCOPe 2.08: d2fzsm_
Chain 'N':
Compound: ATP-dependent Clp protease proteolytic subunit
Species: Escherichia coli [TaxId:562]
Gene: clpP, lopP
Database cross-references and differences (RAF-indexed):
- Uniprot P0A6G7 (Start-192)
Domains in SCOPe 2.08: d2fzsn_
Heterogens: CMQ, PGE, GOL, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>2fzsA (A:)
alvpmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
eyglvdsilthrn