PDB entry 2fzs

View 2fzs on RCSB PDB site
Description: Crystal structure of E. coli ClpP with a Peptide Chloromethyl Ketone Covalently Bound at the Active Site
Class: hydrolase
Keywords: ATP-dependent ClpP protease, Z-Leu-Tyr Chloromethyl Ketone Inhibitor, HYDROLASE
Deposited on 2006-02-10, released 2006-05-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.176
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fzsa_
  • Chain 'B':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fzsb_
  • Chain 'C':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fzsc_
  • Chain 'D':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fzsd_
  • Chain 'E':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fzse_
  • Chain 'F':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fzsf_
  • Chain 'G':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fzsg_
  • Chain 'H':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fzsh_
  • Chain 'I':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fzsi_
  • Chain 'J':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fzsj_
  • Chain 'K':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fzsk_
  • Chain 'L':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fzsl_
  • Chain 'M':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fzsm_
  • Chain 'N':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fzsn_
  • Heterogens: CMQ, PGE, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fzsA (A:)
    alvpmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
    lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
    ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
    eyglvdsilthrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fzsA (A:)
    lvpmviersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspg
    gvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplgg
    yqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvds
    ilthrn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fzsB (B:)
    alvpmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
    lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
    ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
    eyglvdsilthrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fzsB (B:)
    lvpmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiyl
    yinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmi
    hqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeave
    yglvdsilthrn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2fzsC (C:)
    alvpmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
    lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
    ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
    eyglvdsilthrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fzsC (C:)
    vpmvrsfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspggvi
    tagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggyqg
    qatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsilt
    hrn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2fzsD (D:)
    alvpmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
    lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
    ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
    eyglvdsilthrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fzsD (D:)
    lvpmviesfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspgg
    vitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggy
    qgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsi
    lthrn
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2fzsE (E:)
    alvpmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
    lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
    ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
    eyglvdsilthrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fzsE (E:)
    lvpmvieqersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyins
    pggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqpl
    ggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglv
    dsilthrn
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2fzsF (F:)
    alvpmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
    lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
    ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
    eyglvdsilthrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fzsF (F:)
    lvpmvirsfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspgg
    vitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggy
    qgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsi
    lthrn
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2fzsG (G:)
    alvpmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
    lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
    ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
    eyglvdsilthrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fzsG (G:)
    lvpmvsfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspggvi
    tagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggyqg
    qatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsilt
    hrn
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2fzsH (H:)
    alvpmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
    lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
    ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
    eyglvdsilthrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fzsH (H:)
    lvpmvsfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspggvi
    tagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggyqg
    qatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsilt
    hrn
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2fzsI (I:)
    alvpmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
    lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
    ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
    eyglvdsilthrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fzsI (I:)
    lvpmvsfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspggvi
    tagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggyqg
    qatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsilt
    hrn
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2fzsJ (J:)
    alvpmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
    lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
    ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
    eyglvdsilthrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fzsJ (J:)
    lvpmviesfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspgg
    vitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggy
    qgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsi
    lthrn
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2fzsK (K:)
    alvpmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
    lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
    ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
    eyglvdsilthrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fzsK (K:)
    lvpmviersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspg
    gvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplgg
    yqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvds
    ilthrn
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2fzsL (L:)
    alvpmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
    lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
    ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
    eyglvdsilthrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fzsL (L:)
    lvpmvsfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspggvi
    tagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggyqg
    qatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsilt
    hrn
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2fzsM (M:)
    alvpmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
    lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
    ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
    eyglvdsilthrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fzsM (M:)
    alvpmvirsfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspg
    gvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplgg
    yqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvds
    ilthrn
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2fzsN (N:)
    alvpmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
    lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
    ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
    eyglvdsilthrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fzsN (N:)
    lvpmvsfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspggvi
    tagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggyqg
    qatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsilt
    hrn