PDB entry 2fzp

View 2fzp on RCSB PDB site
Description: Crystal structure of the USP8 interaction domain of human NRDP1
Class: ligase
Keywords: E3 Ligase, protein ubiquitination, Structural Genomics, Structural Genomics Consortium, SGC, LIGASE
Deposited on 2006-02-10, released 2006-03-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.172
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ring finger protein 41 isoform 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RNF41
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H4P4 (19-143)
      • cloning artifact (10-18)
    Domains in SCOPe 2.08: d2fzpa1, d2fzpa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2fzpA (A:)
mgsshhhhhhssglvprgstieyneilewvnslqparvtrwggmistpdavlqavikrsl
vesgcpasivnelienaherswpqglatletrqmnrryyenyvakripgkqavvvmacen
qhmgddmvqepglvmifahgveei

    Sequence, based on observed residues (ATOM records): (download) 
    >2fzpA (A:)
ssglvprgstieyneilewvnslqparvtrwggmistpdavlqavikrslvesgcpasiv
nelienaherswpqglatletrqmnrryyenyvakripgkqavvvmacenqhmgddmvqe
pglvmifahgveei