PDB entry 2fzn

View 2fzn on RCSB PDB site
Description: Structure of the E. coli PutA proline dehydrogenase domain reduced by dithionite and complexed with proline
Class: oxidoreductase
Keywords: proline utilization A, proline dehydrogenase, PutA, flavoenzyme, proline catabolism, dithionite-reduced, Oxidoreductase
Deposited on 2006-02-09, released 2006-12-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional protein putA, Proline dehydrogenase (EC 1.5.99.8) (Proline oxidase)
    Species: Escherichia coli [TaxId:562]
    Gene: putA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fzna1, d2fzna2
  • Heterogens: FAD, PRO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fznA (A:)
    lpqsvsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgra
    gmvqgllqefslssqegvalmclaeallripdkatrdalirdkisngnwqshigrspslf
    vnaatwgllftgklvsthneaslsrslnriigksgeplirkgvdmamrlmgeqfvtgeti
    aealanarkleekgfrysydmlgeaaltaadaqaymvsyqqaihaigkasngrgiyegpg
    isiklsalhprysraqydrvmeelyprlksltllarqydiginidaeesdrleisldlle
    klcfepelagwngigfviqayqkrcplvidylidlatrsrrrlmirlvkgaywdseikra
    qmdglegypvytrkvytdvsylacakkllavpnliypqfathnahtlaaiyqlagqnyyp
    gqyefqclhgmgeplyeqvtgkvadgklnrpcriyapvgthetllaylvrrllengants
    fvnriadtslpldelvadpvtaveklaqqegqtglphpkiplprdlyghgrdnsagldla
    nehrlaslssallnsalqkwqalpmleqpvaagemspvinpaepsssvdklaaalehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fznA (A:)
    qsvsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgragg
    valmclaeallripdkatrdalirkgvdmamrlmgeqfvtgetiaealanarkleekgfr
    ysydmlgeaaltaadaqaymvsyqqaihaigkasngrgiyegpgisiklsalhprysraq
    ydrvmeelyprlksltllarqydiginidaeesdrleisldlleklcfepelagwngigf
    viqayqkrcplvidylidlatrsrrrlmirlvkgaywdseikraqmdglegypvytrkvy
    tdvsylacakkllavpnliypqfathnahtlaaiyqlagqnyypgqyefqclhgmgeply
    eqvtgkvadgklnrpcriyapvgthetllaylvrrllengantsfvnriadtslpldelv
    adpvtaveklaqqegqtglphpkiplprd