PDB entry 2fzm

View 2fzm on RCSB PDB site
Description: Structure of the E. coli PutA proline dehydrogenase domain reduced by dithionite and complexed with SO2
Class: Oxidoreductase
Keywords: proline utilization A, proline dehydrogenase, PutA, flavoenzyme, proline catabolism, dithionite-reduced
Deposited on 2006-02-09, released 2007-04-03
The last revision prior to the SCOP 1.73 freeze date was dated 2007-04-03, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.212
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional protein putA, Proline dehydrogenase (EC 1.5.99.8) (Proline oxidase)
    Species: Escherichia coli
    Gene: putA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2fzma1, d2fzma2
  • Heterogens: FAD, SO2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fzmA (A:)
    lpqsvsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgra
    gmvqgllqefslssqegvalmclaeallripdkatrdalirdkisngnwqshigrspslf
    vnaatwgllftgklvsthneaslsrslnriigksgeplirkgvdmamrlmgeqfvtgeti
    aealanarkleekgfrysydmlgeaaltaadaqaymvsyqqaihaigkasngrgiyegpg
    isiklsalhprysraqydrvmeelyprlksltllarqydiginidaeesdrleisldlle
    klcfepelagwngigfviqayqkrcplvidylidlatrsrrrlmirlvkgaywdseikra
    qmdglegypvytrkvytdvsylacakkllavpnliypqfathnahtlaaiyqlagqnyyp
    gqyefqclhgmgeplyeqvtgkvadgklnrpcriyapvgthetllaylvrrllengants
    fvnriadtslpldelvadpvtaveklaqqegqtglphpkiplprdlyghgrdnsagldla
    nehrlaslssallnsalqkwqalpmleqpvaagemspvinpaepsssvdklaaalehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fzmA (A:)
    qsvsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgragm
    gvalmclaeallripdkatrdalirkgvdmamrlmgeqfvtgetiaealanarkleekgf
    rysydmlgeaaltaadaqaymvsyqqaihaigkasngrgiyegpgisiklsalhprysra
    qydrvmeelyprlksltllarqydiginidaeesdrleisldlleklcfepelagwngig
    fviqayqkrcplvidylidlatrsrrrlmirlvkgaywdseikraqmdglegypvytrkv
    ytdvsylacakkllavpnliypqfathnahtlaaiyqlagqnyypgqyefqclhgmgepl
    yeqvtgkvadgklnrpcriyapvgthetllaylvrrllengantsfvnriadtslpldel
    vadpvtaveklaqqegqtglphpkiplprd