PDB entry 2fzk

View 2fzk on RCSB PDB site
Description: The Structure of Wild-Type E. Coli Aspartate Transcarbamoylase in Complex with Novel T State Inhibitors at 2.50 Resolution
Class: Transferase
Keywords: Inhibitors, allosteric transition, Xray structures, Transferase
Deposited on 2006-02-09, released 2006-08-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.211
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aspartate carbamoyltransferase catalytic chain
    Species: Escherichia coli [TaxId:562]
    Gene: pyrB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fzka1, d2fzka2
  • Chain 'B':
    Compound: Aspartate carbamoyltransferase regulatory chain
    Species: Escherichia coli [TaxId:562]
    Gene: pyrI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fzkb1, d2fzkb2
  • Chain 'C':
    Compound: Aspartate carbamoyltransferase catalytic chain
    Species: Escherichia coli [TaxId:562]
    Gene: pyrB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fzkc1, d2fzkc2
  • Chain 'D':
    Compound: Aspartate carbamoyltransferase regulatory chain
    Species: Escherichia coli [TaxId:562]
    Gene: pyrI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fzkd1, d2fzkd2
  • Heterogens: ZN, EOZ, CTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fzkA (A:)
    anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
    tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
    nvpvlnagdgsnqhptqtlldlftiqetqgrldnlhvamvgdlkygrtvhsltqalakfd
    gnrfyfiapdalampqyildmldekgiawslhssieevmaevdilymtrvqkerldpsey
    anvkaqfvlrasdlhnakanmkvlhplprvdeiatdvdktphawyfqqagngifarqall
    alvlnrdlvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fzkB (B:)
    mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
    ientflsedqvdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaep
    vsssfavrkrandialkckycekefshnvvlan
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fzkB (B:)
    thdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdliki
    entflsedqvdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaepv
    sssfavrkrandialkckycekefshnvvlan
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fzkC (C:)
    anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
    tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
    nvpvlnagdgsnqhptqtlldlftiqetqgrldnlhvamvgdlkygrtvhsltqalakfd
    gnrfyfiapdalampqyildmldekgiawslhssieevmaevdilymtrvqkerldpsey
    anvkaqfvlrasdlhnakanmkvlhplprvdeiatdvdktphawyfqqagngifarqall
    alvlnrdlvl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2fzkD (D:)
    mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
    ientflsedqvdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaep
    vsssfavrkrandialkckycekefshnvvlan
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fzkD (D:)
    thdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdliki
    entflsedqvdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaepv
    sssfavrkrandialkckycekefshnvvlan