PDB entry 2fzj

View 2fzj on RCSB PDB site
Description: New Insights into DHFR Interactions: Analysis of Pneumocystis carinii and Mouse DHFR Complexes with NADPH and Two Highly Potent Trimethoprim Derivatives
Class: oxidoreductase
Keywords: dihydrofolate reductase, trimethoprim derivatives, ring stacking interactions, OXIDOREDUCTASE
Deposited on 2006-02-09, released 2006-12-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.234
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: Mus musculus [TaxId:10090]
    Gene: Dhfr
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fzja_
  • Heterogens: NDP, DH3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2fzjA (A:)
vrplncivavsqnmgigkngdlpwpplrnefkyfqrmtttssvegkqnlvimgrktwfsi
peknrplkdrinivlsrelkepprgahflakslddalrlieqpelaskvdmvwivggssv
yqeamnqpghlrlfvtrimqefesdtffpeidlgkykllpeypgvlsevqeekgikykfe
vyekkd